KEGG   Sinocyclocheilus grahami: 107565745Help
Entry
107565745         CDS       T04918                                 

Definition
(RefSeq) centrosomal protein of 72 kDa-like isoform X1
  KO
K16532  centrosomal protein CEP72
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107565745
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     107565745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_9 LRR_8 LRR_4 DUF776 CorA
Motif
Other DBs
NCBI-GeneID: 107565745
NCBI-ProteinID: XP_016106501
LinkDB All DBs
Position
Unknown
AA seq 519 aa AA seqDB search
MAVDGLTTTEQWIREKLQLQHSCLADVRSLTLPGTYEGKICHLGASLKNFVRLKSLDLSH
NALRTVQGIEHLEMLERLNLYYNRLASLPDVFSLHKLQNLKELDLRLNPVVRKHPLYRLY
LVHTMTKLRKLDDCPVRDRERKAALMHFSSEANLDTNHKKHASTQDTTCRSSELRIKATQ
KMMKTLSLLEGNEEAALNDVCRTRAETLSVRFENERSPRLFQENPSESDIIHLINGPECE
RSPKQNKESVPKSWEYKKEAPAGSQRVTFESRSLTHATVRGESVFTPHPTEMRSDSHALK
WQNQLQDRANPVLHPPRLTYQITGASSASPRKCKPQKGAYRKPMELLLSMMEELWSGKKE
NQQNRTFLMKMVQILSMMEQDVVAGEQQIQTLQEMLKALKTRTELQEKQHRSETEDLKLQ
LQQAQESIQALNEQMKSVLEENVSLQKQLIKAENKLLSSRLKKMPDMQDRGQQTVPEELN
VKRHTIQEGNGANEPQESYRSLIARNERLLQQLEEALMN
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggacggcttgaccacaacagagcagtggatcagagaaaagctccagcttcag
cacagctgtttagcggatgtgcgatcgttgactcttccaggaacatacgaagggaaaatc
tgtcatttaggagcatcgctaaagaactttgtgcgtctgaagtctctggatctttcccat
aatgcactgcgcacagttcaggggattgagcatttggaaatgctggagagactgaatctg
tactacaacaggctggcgtctctgccggacgtcttttccctgcacaagctgcagaatctg
aaggaactggacttgcggctcaatcctgtggtcaggaaacacccgctttaccgtttgtac
ctggtccacacaatgaccaaactccgcaagcttgatgactgtccagtgcgagaccgagaa
agaaaggcagctctcatgcatttctcatccgaggcaaatctagacactaatcataagaaa
catgcctcgacacaagacacaacgtgcagaagtagtgagctccgaatcaaagccacgcag
aagatgatgaagacgctctcgcttctcgaggggaacgaggaagctgcgcttaatgatgtt
tgtagaacgagagctgaaactctctccgtccgctttgagaacgagcgcagccctcgtctg
ttccaggaaaatccttccgaatcagatatcatacatttgatcaatggaccggagtgcgaa
aggtcgccaaaacaaaacaaggagtctgttcccaagagctgggaatataaaaaagaggct
cctgctggttctcagcgagtgacgtttgagagccggagtctgactcacgctacggttcga
ggagagagcgtctttacacctcatcctacagaaatgcggtccgattcgcacgctcttaaa
tggcaaaaccagcttcaggacagagcaaatccagtcctgcatcctcccagattaacctac
cagatcacaggagcctcgtcggcatcaccgagaaaatgcaaaccacaaaagggtgcctac
aggaagcccatggagctgctcctcagcatgatggaggagctctggtcggggaagaaggag
aatcaacaaaacaggaccttcctcatgaagatggtccagatcctcagcatgatggagcag
gatgttgtggcaggagaacagcagatacaaactctgcaagagatgctcaaagccttgaaa
acacggactgagttacaggaaaaacagcatcggtctgagactgaagatctcaaactccag
ctccagcaggcgcaagagtccatccaagcccttaatgaacagatgaagagcgtgctggag
gagaacgtgtctttacagaaacagctgatcaaagcagaaaacaagctgctgtcgtctcgg
ctgaagaagatgccagacatgcaggacagaggacagcagacggtccctgaggagttaaac
gtgaaaaggcacacaattcaggagggcaacggagcgaatgagccgcaggagagctacagg
tctttgattgccagaaatgagcgtttgctgcagcagctggaagaggctctgatgaactaa

DBGET integrated database retrieval system