KEGG   Sinocyclocheilus grahami: 107566633Help
Entry
107566633         CDS       T04918                                 

Gene name
sdha
Definition
(RefSeq) LOW QUALITY PROTEIN: succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00020  Citrate cycle (TCA cycle)
sgh00190  Oxidative phosphorylation
sgh01100  Metabolic pathways
sgh01200  Carbon metabolism
Module
sgh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sgh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sgh_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107566633 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107566633 (sdha)
Enzymes [BR:sgh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107566633 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 107566633
NCBI-ProteinID: XP_016107609
LinkDB All DBs
Position
Unknown
AA seq 666 aa AA seqDB search
MAAVCAASRVLGRKIVSSKALPVVWQTSNRKLHFSVYGKGGDAKVSDAISTQYPVVDHEF
DAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDDWRWH
FYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTEEGRIYQRAFGGQSLKFGK
GGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECKGVIALCMEDG
SIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGNAMVTRAGLPCQDLEFVQFHPTGIYG
AGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSMTIELREGRYNILNLY
YNINLLFCAQNTFLRFQTDPECENSIQILIALXWLHHNVNVQITVWKXFSXEHDTNILXS
SQVITHKDGEDTVVPGLYACGESGCASVHGANRLGANSLLDLVVFGRACALTIAETDTPG
EKLSPLKPNAGEASVANMDKIRFANGSTRTSEIRLNMQKTMQSHAAVFRTGDTLKEGCDK
MDSVYKSLDDIKTFDRGIVWNTDLVETLELQNLMLNGVQTIVSAEARTESRGAHAREDFK
DRVDEYDYSKSLQGQVKKPFEQHWRKHTLSYVDPKTGKVTLEYRPVIDNSLNAEECAAIP
PAIRSY
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggtgtgcgctgcctcccgtgtcctcggaagaaagattgtgtcatctaaagct
ctgccagtggtgtggcagacgagcaaccgcaagttgcatttctccgtctatggaaaaggg
ggagatgcaaaagtctcagatgctatctccactcagtatccagtagtagaccatgagttt
gacgctgtcgtggtgggagccggtggcgcaggcctgcgtgcagctttcggtctgtcggag
gccggttttaacacagcctgtgtcaccaaacttttccccacccgctcacacacagtggcc
gcacagggtgggattaatgccgcattgggcaacatggaggaggacgactggcgttggcac
ttttatgacacagtgaagggatctgattggctgggagatcaggatgccattcactacatg
acagagcaggcgcctgctgcagtggtagagctggagaactttggtatgccgttcagccgt
accgaggaagggaggatctatcagcgtgccttcggaggccagagtctgaagttcggtaaa
ggaggtcaggctcacagatgctgttgtgtggcggacaggacgggtcactctcttcttcac
acgctctatggacggtctctaaggtatgacaccagttattttgtggaatattttgccctg
gatctgctgatggaggatggagagtgtaagggagtcattgcgttgtgcatggaggacgga
tccatccaccgtttcagagccaagaacacagtcatcgccactggtggttatggccgcaca
tacttcagctgtacatcagcccataccagcacaggagacggtaatgccatggtgacccgt
gctggtctgccttgccaggatctcgaatttgttcagttccaccccacaggaatctatgga
gccggatgcctgatcacagagggttgccgtggagagggaggaatcttgatcaacagtgaa
ggcgagaggttcatggaacgttatgcacccaatgctaaagatttggcctctagagacgtg
gtctcacggtccatgaccatcgagctcagggaaggaaggtataatatacttaatctttac
tataatattaatctgctattttgtgcccagaacacatttcttcgtttccaaacagaccca
gaatgtgaaaatagtatacagattttgattgcattatgatggttacatcataacgtaaat
gttcaaatcactgtgtggaagtgattctcttgagaacatgacactaatatcctctaatcc
tcgcaggtcatcacccataaggatggagaggatacggtggtgccaggcctgtacgcctgc
ggtgagagtggctgtgcatcggtgcacggtgccaaccgcctgggtgccaactcactgctg
gatctggttgtgtttggacgcgcttgtgcccttaccattgctgagacagacactccagga
gagaagctttcccctctgaaacccaatgcaggagaggcgtctgtcgccaatatggacaag
atccgctttgctaacggcagtaccagaacctcagagatcagactgaatatgcagaagacc
atgcagagtcacgctgctgtgttccgcactggagacaccctgaaggaaggttgtgacaag
atggactccgtctacaagtcactggatgacatcaagacatttgacagaggcattgtctgg
aacactgatctggtggaaactctggagctgcagaatctgatgttgaacggagtgcagaca
atcgtctccgctgaggcccgtacagagagcagaggagctcatgcccgcgaggacttcaag
gaccgtgtggatgagtacgattactctaagtctctgcagggacaagtgaagaagcctttc
gagcagcactggaggaaacacacactgtcctacgtggatcccaagacaggaaaggttact
ctggaatacagacctgtgattgacaactctctgaacgcagaggaatgtgctgccattccc
cctgcaatccgctcctattaa

DBGET integrated database retrieval system