KEGG   Sinocyclocheilus grahami: 107566938
Entry
107566938         CDS       T04918                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta-like
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04141  Protein processing in endoplasmic reticulum
sgh04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107566938
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107566938
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107566938
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107566938
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA DUF4140 CENP-H
Other DBs
NCBI-GeneID: 107566938
NCBI-ProteinID: XP_016108000
LinkDB
Position
Unknown
AA seq 618 aa
MTAELDSRFCADNLLTSEDWDACLYQCEDMEEDFTGELKYDTSLDSDLVLTLDPDNPTSP
WKNLDDNLTGEVSVMKDYNRTITQPLTVDMFFQVKTEPPSPASSLTSDSSISSLPEAQVT
VKSENPPTPPYMYGDVLSPPLTSVEVTVTSVSPLHQPPLPLAIQPHALSSLDTQTTVLSS
AASLKASSILSSKPLIQPKPVCVAALPVAQSTSPAKALFLQSVPVPIPAVDQNTTPVVLS
QSVCLGSAPAIVKMEPLSPSMLHCTSPSAPPPSKPIIPASSLTGNSCSDIDMKVLKRQQR
MIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRRENQALRLRLAGREATESGSNKR
ALCVMALFLFITFTFSPVRQQAYSTTRVDQVNQGNEDLQTNRFVQSALLSLRFSIRLADE
LRGWVHRHQNNRKSNGKAKVVKKTKIAQKAQHRKTNFSRYLPIQAHRSIESQLQVLPGPE
ISYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTTRPKMSLVMPAMAINDSVYNSSQ
GGYEMMMQVDCEVMDTRIIPIKSSVVPPSLRDPPPAPPPHHHHGNHTSLRSRQQHLHGSG
ASSRRRAAGYFISQSGSD
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgaccgcggagctggacagtcgcttctgcgccgataacctgctaaccagcgaggactgg
gatgcctgtctgtatcagtgtgaggatatggaggaggatttcaccggagaactgaaatat
gacacatcgctggacagtgatcttgtcctcacgctggaccctgataaccccacatcaccg
tggaagaacctggatgacaacctgacaggtgaagtgtcagtcatgaaggattataacagg
actataacacaacctctgacagtggacatgtttttccaggtgaagactgaacctccttca
cctgcgtcgtctctgacctctgacagctccatctcatctttacctgaagctcaggtgacg
gtgaagagtgagaacccgcccactccaccgtacatgtatggagacgtgctctcgccgccg
ctgaccagtgtggaggtaaccgtcaccagcgtctctccactgcatcagcctccccttcct
ctggccatacagccacatgctctcagcagcctcgacacacaaaccacagtcctctcctca
gcagcgtcgctgaaggccagcagcattctgagcagtaaacctctgatccagcccaaaccc
gtgtgtgtggccgcgctgccggtggctcagagcaccagtccagccaaagctctcttcctg
cagagcgttcccgtacccatcccagccgtcgaccagaacaccacgcccgtggttctgtct
cagtcggtgtgtctgggttctgctcctgctattgttaaaatggagcctttgtctcccagc
atgcttcactgcactagcccctcagccccgcccccgagcaaacccatcatcccagcatcc
agcctgactggaaacagctgcagtgacatcgacatgaaggttttgaagaggcagcagcgt
atgataaagaaccgggaatcggcctgccagagccgcaagaagaagaaggagtacctgcag
aacctggaggcgcagctgcgggaggcgcagcaggagaacgagcgcctgcgcagagagaac
caagcgctgcggctgcgactcgccgggagagaggctacggagtctggcagcaacaagaga
gctctgtgtgtgatggctctgttcctcttcatcacctttaccttcagccccgtcagacag
caagcatacagtacaactcgtgtagatcaggttaatcaaggtaatgaagatcttcagaca
aacagatttgttcagagtgctttactctctctccgtttctccatcaggttggcagatgag
ctgcgaggatgggtccatcgtcatcagaataaccggaagtctaatggaaaggcgaaggtt
gtgaagaaaactaaaatagctcagaaagctcagcacagaaagacaaacttttccaggtac
cttccaattcaggctcatcgttctatcgaaagtcagctgcaggtcctgcccgggccagag
atcagctacagcgactttctggatgctattgatcggcgtgaggacactttctacgtcgta
tcattcagacgggatcacctgctgttacctgccatcagccacaataaaacaactcgaccc
aaaatgtctctggtcatgcctgccatggccatcaatgattcggtgtataactcgtctcag
ggcggctatgaaatgatgatgcaggtggactgtgaggtgatggacacccggatcatccca
atcaagtcctctgtagtcccgccctctctcagagacccgcccccagctccgccccctcac
catcaccacggcaaccacacctccctccgcagccgacagcagcacttgcatggcagcggg
gcgtcgtcgagacggagggccgcgggttacttcatcagccagagcggatccgattga

DBGET integrated database retrieval system