KEGG   Sinocyclocheilus grahami: 107567242Help
Entry
107567242         CDS       T04918                                 

Definition
(RefSeq) procollagen galactosyltransferase 1-like
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00310  Lysine degradation
sgh00514  Other types of O-glycan biosynthesis
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107567242
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107567242
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sgh01003]
    107567242
Enzymes [BR:sgh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     107567242
Glycosyltransferases [BR:sgh01003]
 O-Glycan biosynthesis
  O-linked Gal type
   107567242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1 CAP59_mtransfer
Motif
Other DBs
NCBI-GeneID: 107567242
NCBI-ProteinID: XP_016108370
LinkDB All DBs
Position
Unknown
AA seq 609 aa AA seqDB search
MLWFVLFVSVLWCCLMNTGPAQAYFHEERWSPESPILAPRVMIALICRNAQHSLPHFLGT
IERLNYPKDRIALWVATDHNIDNTTYLLRDWLINVQKLYHYVEWRPKEEPRKYHDEDGPK
EWTNERYAYVMRLRQAALESAREMWADYLMMIDCDNLLINRDVLWKLIKENKTIVAPMME
SRAAYSNFWCGMTSQGYYKRTPAYIPMRKQVRRGCFAVPMVHSTFLVDLRKEASRLLAFH
PPHPDYTWAFDDIIIFAFSARMAEVQMFICNTETYGHLPVPLRAHSTMQDAADSFIHTLL
EVNVRNPPVEPSRYLPKPVKRPDKMGFDEVFMINLKQRADRRERMLGALREQEIDCKIIA
AVDGKAMNSSEIHAMGIHMLPGYSDPYHGRPLTRGELGCFLSHYNIWKEIVDRGLKTSLV
LEDDLRFEIFFKRRLQNLMSEVESKSLDWDLIYIGRKRMQVDRPEKAVPNIRNLVEPDYS
YWTLSYMMSLQGAKKLLKAEPLSKILPVDEFLPIMFNKHPVSDYMEQFETRDLKAFSAEP
LLVFPTHYTGEPGYISDTETSTVWDNEKVRTDWDRKRSGKTREQAEISTEAQNSDVLQSP
LDRTARDEL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgctctggttcgtgttgttcgtgtcggtgctgtggtgctgtctgatgaatactggacca
gctcaagcatacttccatgaagagcgctggagcccggagtctcctatattagctccccga
gtaatgatcgctctgatctgccgtaacgcccagcactcgctgccacatttcctcgggacc
attgagcgcctcaattaccctaaagaccgaatcgcgctgtgggtcgcaaccgaccacaat
attgacaacactacttacctactgcgagactggctcatcaatgtacagaaactctaccat
tatgtggagtggaggccaaaggaggaaccaagaaaatatcatgatgaggacggaccaaag
gaatggacgaatgagcgttacgcctacgtcatgagactgcggcaggcagcgcttgagtct
gcacgagagatgtgggcagactatctcatgatgattgattgtgataatctcctgatcaac
cgagatgtcttatggaaactaataaaggagaacaagacaattgtggcaccaatgatggag
tctcgtgctgcctactcaaacttctggtgtggaatgacatctcagggctactataaacga
accccagcctacatccccatgcgcaagcaagtgcgtaggggttgctttgccgttcccatg
gtgcattcgactttcctggttgacctgcggaaagaagcttccagactgcttgcttttcac
ccaccacatccagactacacctgggcctttgatgacattataatctttgctttttcagcc
cgcatggcagaggtccaaatgtttatttgtaacacggagacctacggtcatctcccagtg
cctcttcgtgcccacagcaccatgcaggatgcggccgacagcttcattcatactttgctg
gaggtcaatgtgcgaaatcctccagttgagccttccagatacttgcccaaacctgtcaaa
agacctgacaaaatgggctttgatgaggtgtttatgatcaacctgaagcagcgggccgac
cgtcgtgagcgcatgctgggggcgttgagagagcaagaaatcgactgcaagattatcgct
gctgttgatggcaaggctatgaacagcagtgagatccatgctatgggaatccacatgctt
cccggctatagtgacccctaccacggcagacctctgacgagaggagagctgggctgcttc
ctgtcccactataacatctggaaagagattgtagaccgaggcctgaagacctcactggtt
cttgaagatgatttacggtttgagattttcttcaagcgccgcctgcagaatctgatgagt
gaggtggagagtaagagtctggactgggacctcatttatattgggaggaagaggatgcaa
gtggaccgacctgaaaaagcagtaccgaatattcgcaacctggtggagccggactattcc
tattggaccttgagttacatgatgtcattacaaggagccaaaaagctcctcaaagcagaa
ccactcagtaaaattctgcctgtggatgagttccttccaattatgtttaataagcatcct
gtatcggattacatggagcagtttgagacaagggacctaaaagcattctcagcggagccc
ttgcttgtgtttcctacacactacacgggtgaacctgggtatatcagtgacacagaaacc
tccacagtgtgggacaatgagaaagtgcgcacagactgggacaggaagcgctcgggtaag
acccgggaacaggctgagatcagcacagaggcccaaaactcagatgtgcttcagtctcct
ctggacaggacagcccgagatgaactatga

DBGET integrated database retrieval system