KEGG   Sinocyclocheilus grahami: 107568177
Entry
107568177         CDS       T04918                                 

Gene name
tgfa
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107568177 (tgfa)
   04012 ErbB signaling pathway
    107568177 (tgfa)
SSDB
Motif
Pfam: Mucin SSP160 PepSY_TM EGF Laminin_EGF DUF4834 FSA_C DUF3439 CBP30
Other DBs
NCBI-GeneID: 107568177
NCBI-ProteinID: XP_016109578
LinkDB
Position
Unknown
AA seq 215 aa
MLLFRCFLIAVTVMSLAIFDFVGSSFSHLGSLFTYGQVQENSTSTTTIATTTTTTTTTTT
TTTTSTTTTTTTSRVKKFIAAAVHSHFDDCPDSHSHFCFHGTCRFLILEETPACVCHPGF
VGMRCEHADLLAVVASNHRQQTVATMLVLCVVGSVLLMLLCTLLNCWWRRGGCGRGNTIS
CWSEKPRSILTGGTSCCHSETGILVLYFHFYTTFC
NT seq 648 nt   +upstreamnt  +downstreamnt
atgctgttgttccgctgttttctcattgctgtaacggtcatgagtctggcaatttttgac
tttgttggatcctcattttcacatttgggatccctttttacatatgggcaggtgcaagag
aattctacctcaacaacaaccattgcaaccaccacaacaacaactaccaccactaccaca
acaaccaccaccagcacgaccacaaccactactacttcacgtgtcaaaaaatttatagca
gccgctgtccactctcacttcgatgactgccctgactcccatagccacttctgttttcat
ggcacatgccgctttctcatactggaggaaacacctgcatgtgtatgtcatcctggcttt
gtgggtatgcgatgtgaacatgcagacctcttggcagtggtggcgtctaaccacaggcaa
cagactgtggccaccatgctggtgttgtgtgtggtgggcagtgttctactcatgctgctt
tgcacgttactaaattgttggtggagacggggtggttgtgggcgaggtaacaccatttcg
tgttggtcggagaagcctaggagtattctgactggtgggacatcctgctgtcactcagaa
acaggtattctggtgctatatttccatttttacacaactttttgctga

DBGET integrated database retrieval system