KEGG   Sinocyclocheilus grahami: 107568389Help
Entry
107568389         CDS       T04918                                 

Definition
(RefSeq) protein lyl-1-like
  KO
K15604  protein lyl-1
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107568389
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Lymphoid factors
    107568389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH COE1_HLH
Motif
Other DBs
NCBI-GeneID: 107568389
NCBI-ProteinID: XP_016109836
LinkDB All DBs
Position
Unknown
AA seq 318 aa AA seqDB search
MMEKNEPAISPSSPSPSVLQNVSPARMSSPEANAACDAESPTDSRPSAAEPEATGAKPRP
SPPVTSLPPNIPVISLAHSKPPLPPLSMLTALHPAPRLLYGPTELRPAAALLPPPFLQTH
PFISSSFLGPSGSFGIFGNARMKRRPSTHFELELNDGPPQKMARRVFTNSRERWRQQNVN
GAFSELRKLIPTHPPDKKLSKNEILRLAMKYINFLVQLLKDQTGDQACKGTTGGVEDREK
DGSEALGSSSSPSRNNRDSTDSMTVLTASSASSCYGDTDSEESTGPRPCGVETKHGGSGI
TEKVQEQILAVTASSYQR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatggagaagaacgagccagccatctcgccctcctcaccgtctccgtctgtcctccag
aacgtcagccctgctcgcatgagttcgcccgaggctaatgcggcttgtgacgcagagagc
cctacggacagcaggcccagcgcagcggaaccagaggccactggagccaagccccggccg
agcccccccgtcacgtccctcccgcccaacatcccggtcatcagcctggctcacagcaaa
ccccccctgcctcccctctccatgctgacggccctgcaccccgctccgcgcctcctttac
ggccccacggagctgcgacccgctgcggccctcctgcctccgcccttcctgcagacgcac
cccttcatcagcagctctttcctcggaccatctgggagctttgggatctttgggaatgct
cgtatgaagagacggccgtccacacacttcgaactggagctcaatgatggtcctcctcag
aagatggctcggcgcgtcttcactaacagccgcgaacgctggcgacaacagaacgtaaat
ggtgctttctctgagctccgcaaactcatcccgacccacccgcctgacaagaagctcagc
aagaacgagatcctgcgcctcgccatgaagtacatcaacttcctcgtgcagctgctgaag
gaccagacgggcgatcaggcgtgtaaaggcacaacggggggtgtggaagaccgggagaag
gatggaagtgaagctttgggaagcagcagctccccgtcccgtaataacagagactccacg
gactccatgacggtgctgacggcgtcgtcggcctccagttgttacggtgacacggacagt
gaggagagtacggggccacggccctgcggcgttgagacgaaacatggcggcagcgggatc
acggagaaggttcaggaacagattctagcagtcacagcgagcagctaccagcggtga

DBGET integrated database retrieval system