KEGG   Sinocyclocheilus grahami: 107569270Help
Entry
107569270         CDS       T04918                                 

Gene name
pfkp
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00010  Glycolysis / Gluconeogenesis
sgh00030  Pentose phosphate pathway
sgh00051  Fructose and mannose metabolism
sgh00052  Galactose metabolism
sgh01100  Metabolic pathways
sgh01200  Carbon metabolism
sgh01230  Biosynthesis of amino acids
sgh03018  RNA degradation
Module
sgh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107569270 (pfkp)
   00030 Pentose phosphate pathway
    107569270 (pfkp)
   00051 Fructose and mannose metabolism
    107569270 (pfkp)
   00052 Galactose metabolism
    107569270 (pfkp)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    107569270 (pfkp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107569270 (pfkp)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sgh03019]
    107569270 (pfkp)
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     107569270 (pfkp)
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107569270 (pfkp)
Messenger RNA biogenesis [BR:sgh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     107569270 (pfkp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 107569270
NCBI-ProteinID: XP_016110794
LinkDB All DBs
Position
Unknown
AA seq 835 aa AA seqDB search
MPDTKKFIENLSGAGKCIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIHEGYQGMVD
GGDNIKEASWESVSSMLQVGGTVIGSARCKDFRTHEGRLHAALNLVQRGITNLCVIGGDG
SLTGANLFREEWSGLLDELVQSGEISEEASQIHSALHIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPKDGWE
EQMCYKLSENRADKKRLNIIIVAEGAIDQSNKPITTELIKDLVVRCLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEASPGTPACVVSLCGNQAVRVPLMECVQMTQEVQK
AMDEKRFEEAVRLRGRSFENNLNTYKLLSHRKIDSELPHSSFNVAVLNVGAPAAGMNAAV
RSAVRVGITEGHTMFAVSDGFEGFYKGQIKEIKWGDVGGWTGQGGSLLGTKRTLPAKHID
KIAEQMRIHNINALLVIGGFEAYLGLMELQAARSKHAELCVPMVMVPATVSNNIPGSDLS
IGADTALNAITDAFESLLQLVDARSRYEEFCVPMCMLPATISNNVSGTDLSIGADTSLNA
IVETCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADAAYIYEEPFDIRELQSN
VEHLTEKMKTSIQRGLVLRNENCSENYTTDFIYQLYNEEGKGVFDCRKNVLGHMQQGGAP
SPFDRNFGTKIAAKAMQWISKKLKEFYREDEGRVFANTEDSACLLGMRRRALVFQPVVQL
KDETDFVHRIPKEQWWLRLRPLMKILAKYKTSYDVSDSGQLEHIVRLRAKDISAI
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgccggacaccaaaaaattcatcgagaacctgtctggtgcagggaagtgcattggcgtc
ctgacaagtggtggagatgctcaaggtatgaatgctgctgtgagggcagtggtcagaatg
ggaatctatgtgggagcaaaagtttatttcatccatgagggctaccagggcatggtggat
ggaggtgacaacatcaaagaggcatcatgggaaagtgtttccagtatgttacaagtgggt
ggcaccgtgattggcagcgcccgttgtaaggattttcgcacccacgagggccgtttgcat
gctgctctgaacctggtacagcgtggcattactaacttgtgtgtgattggtggagatggc
agtttgaccggggctaatctcttcagggaggagtggagcggactgttggatgagcttgtc
caatcaggtgaaatcagtgaagaggcttcccaaattcattctgcattgcatatcgttggg
atggtgggctcaatagacaatgatttctgtgggacagatatgaccattggcactgactca
gcactgcacaggatcatagaggtggtggacgccataatgaccacggcacaaagccatcag
aggacctttgtgctggaggtcatgggaagacactgcgggtatctagcattagtcagtgct
cttgcatgtggagctgactgggtgctgattccagaaatgcctcccaaagatggctgggag
gaacagatgtgttataaactatcagagaatcgtgctgataagaaacggcttaatatcatc
atagtagctgaaggtgcaatagaccaaagcaacaagcccataaccacagaacttataaag
gatctggtggtgcgctgcttggggtttgacacgcgggtcaccattctgggtcacgtccag
agaggaggaacaccctctgcctttgaccggattttggcgagtcgtatgggagtggaagcc
gtcttggccctgttagaagcttctcctggtactccagcatgtgtggtgtctctgtgtggg
aaccaggctgtcagggttcctctgatggagtgcgttcagatgacgcaggaggtccagaag
gccatggatgaaaagcgatttgaagaagctgtaaggctgcgtggcagaagtttcgaaaac
aacctgaacacttataaactcttgtctcatcgaaaaattgattctgaacttccacatagc
tcatttaatgtggctgtgttgaatgttggcgctcctgcagctggcatgaatgcagccgtg
cgttcggccgtcagggttgggatcaccgaaggccacactatgtttgctgttagtgatggg
tttgagggcttctataagggacagattaaagaaatcaagtggggtgatgttgggggctgg
acaggccagggcgggtccctgctaggaacaaaaagaactctcccagccaagcacattgat
aaaattgcagaacagatgaggattcacaacatcaacgctttactggttattggaggtttt
gaggcttatttggggctgatggagctgcaagcagctcgttccaaacacgcagagctttgt
gttcccatggtgatggtcccggccactgtgtccaacaatatccccggctcagacctgagt
atcggggcagacacggccctcaacgccatcacggacgcctttgagagtttgctgcagctg
gtcgatgcccgcagcaggtatgaggagttctgtgtgcccatgtgcatgctgcctgccacc
atcagtaataatgtgtccggcactgacctcagcattggcgctgacacttccctcaatgcc
atagtggagacgtgtgatcgtataaagcagtcggccagtggaaccaagcgccgcgtgttc
atcattgagacgatgggaggttactgtggttacctggcgacggtgggtgggctggcggcc
ggagcggatgcagcctatatctatgaagagccgtttgacatccgagaactacagtctaac
gttgaacatttaactgagaagatgaagaccagcatccagagaggtttagtgctcaggaat
gagaactgcagtgaaaactacaccactgacttcatctaccagctgtacaatgaagagggc
aaaggagtctttgactgcaggaagaacgtcctgggacacatgcagcagggtggtgctcct
tccccgtttgacaggaactttggcactaagatcgcagctaaagccatgcagtggatctcc
aagaagctcaaagagttttacagagaagatgaaggacgtgtgtttgcgaacacagaggat
tctgcgtgtttgttggggatgcggcgaagggctctggtctttcagcccgtcgtacagctg
aaggatgagacggattttgttcacaggatcccgaaggaacagtggtggctccgtctgcgt
ccactaatgaagattctggccaagtacaaaaccagctacgacgtgtccgattcgggccag
cttgaacacatcgtccgtctgagagctaaagacatctctgccatttaa

DBGET integrated database retrieval system