KEGG   Sinocyclocheilus grahami: 107569753
Entry
107569753         CDS       T04918                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04012  ErbB signaling pathway
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
sgh04115  p53 signaling pathway
sgh04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107569753
   04068 FoxO signaling pathway
    107569753
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107569753
   04115 p53 signaling pathway
    107569753
   04218 Cellular senescence
    107569753
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107569753
NCBI-ProteinID: XP_016111393
UniProt: A0A672MWC9
LinkDB
Position
Unknown
AA seq 145 aa
MAMHKRILRALGNVPTRRNLFGPVDREQLQLEYRDALRKDLEEASRRWSFDFVSETPLEG
GDFLWEGVSGEKVPVLYRAGQEGKHPRLRVGKENIPRTPERFNAVPRDVEKTPEKSTELK
RKQTSITDFYQAKKRVVVTPRKSGQ
NT seq 438 nt   +upstreamnt  +downstreamnt
atggcgatgcacaagcggatcctgcgagctctcgggaacgtcccgacgcggcggaacctc
ttcgggccggtggatcgcgagcagctccagctggagtaccgcgacgctctgaggaaggac
ctggaggaagcatcccgccgctggagcttcgacttcgtctcggagacacctctggagggc
ggagacttcctgtgggagggcgtgtccggggaaaaggtgcccgtcttgtaccgcgccggt
caggagggcaagcatccgcggctgcgcgtgggtaaagagaacatccccagaaccccagag
agattcaacgctgtcccgcgggacgtggagaaaacgccagaaaagagtacagagctgaag
aggaagcagacgagtatcacggatttctaccaggcgaagaagagagtggtggtcacaccc
cgcaaatcaggacaataa

DBGET integrated database retrieval system