KEGG   Sinocyclocheilus grahami: 107570700Help
Entry
107570700         CDS       T04918                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00052  Galactose metabolism
sgh00500  Starch and sucrose metabolism
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107570700
   00500 Starch and sucrose metabolism
    107570700
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     107570700
    3.2.1.20  alpha-glucosidase
     107570700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 DUF5110 Peptidase_S77
Motif
Other DBs
NCBI-GeneID: 107570700
NCBI-ProteinID: XP_016112447
LinkDB All DBs
Position
Unknown
AA seq 660 aa AA seqDB search
VTFLPTPALTYRTVGGILDFYMVMGPTPEAVVQQYTEMIGRPVLPAYWSLGFQLCRYGYS
NDAEIADLYRDMKAAKIPYDVQYADIDYMERQMDFTLDKVNFKGLPALVDNMRAEGMRFI
FILDPAIAANETKGSYPAFDTGVEKDIFIKWPPELSNDIVWGKVWPDYPNITVDNSLDWD
TQVELFRAFVAFPDFFKSSTAEWWAQQIKDFYNNVMKFDGLWIDMNEPASFVHGTVGEKC
LGDPALENPPYMPPLESMHRGLNHKTLCMNSEQILADGTRVKHYDVHNLYGWSHTKPTYD
ALLSATEKRGVVVTRSTYPSSGRWAGHWLGDNYSAWDQLLKSIIGMMEFSIFGIPYTGAD
ICGFFNPAQYEMCLRWMQLGAFYPFSRNHNTINMPRQDPVAWGPEFAAISRDVLNIRYTL
LPYLNTLMYEAHAHGNTVVRPLLHEFVTDENTWSIDRQFLWGPALLITAALDPGVSVVRG
YVPNARWYDYHTGEVVGVRGQFMNMDTPLSKINLHVRGGHILPWQKPENNTHYSRLNPLG
LLVALDDGGSAHGSLFWDDGEGIDTVQNKRFLLTSFSVSSGVLTSAVLTDGLAEADRLTL
GVVKVWGVSAPVTQVIMKVTGKPDAKLEFTYNAEVQELQFDATSQSHTIEKPFTITWSSA
NT seq 1985 nt NT seq  +upstreamnt  +downstreamnt
atgtgaccttcttgcctactccagctctgacctaccgcaccgtcggaggcattctggact
tctacatggtgatgggacccactccagaagctgtggttcagcagtacactgagatgatcg
gccgcccggttcttccagcctattggtcgcttggattccagctttgtcgttacggctact
ccaacgatgcagagatcgcagatctttacagagacatgaaagctgctaaaattccttatg
atgttcaatatgcagacattgactatatggagaggcagatggactttacgctggacaaag
tgaacttcaagggactgcctgctctggtggacaacatgagggctgaggggatgcgcttca
tcttcatcttggacccggctatagcagccaatgagacaaaaggctcctaccctgcatttg
atactggggttgaaaaagacattttcatcaaatggcctcccgagctcagcaatgacattg
tgtggggaaaggtgtggcctgattatcccaatattactgtggacaattctttggactggg
atactcaagtagagctattcagagcttttgtggcgttccctgatttcttcaagagcagta
cagcagaatggtgggcacagcagattaaagacttttacaacaacgtcatgaagtttgacg
gactttggatcgacatgaatgagccggccagtttcgtgcatggcaccgtcggagagaaat
gcctaggggatcccgccttggaaaaccctccatacatgccccctctggagtccatgcaca
gaggcctgaaccataaaactttatgcatgaacagcgagcagatcctggctgatggcacac
gcgtcaagcattatgatgtccacaacttatatggctggtctcacacgaaacctacttatg
atgctttgcttagtgccactgaaaagagaggtgtcgtagttacccgttcaacatatccgt
ctagtggtcgctgggcaggacattggttgggagacaactactccgcctgggaccagcttc
tcaagtccatcataggcatgatggagttcagcatatttggcatcccttacaccggtgctg
atatctgtggcttctttaaccctgcccaatacgagatgtgcctgcgttggatgcagcttg
gagctttctacccgttctccagaaaccacaacaccataaacatgccaaggcaggatcccg
tggcctggggaccggagtttgctgctatctctcgtgatgtgctgaatattcgctacaccc
tcctgccgtatttgaacacactgatgtacgaagctcacgctcacggaaacactgtggtca
gacctctgcttcatgagtttgtgacagatgaaaacacatggagcatcgacaggcagttcc
tctggggtcccgcgcttctcatcacagctgctttagacccgggcgtgagtgtggtcaggg
gctacgtgccaaacgcccgctggtacgactaccacacgggtgaagttgttggagtgcgag
gacagttcatgaatatggatacaccgttatcgaaaattaacctgcatgtgagaggaggcc
acatcctgccctggcagaaaccagagaacaacacacactacagtcgtctgaatcctctgg
gtcttcttgttgctcttgatgatggaggttcagcacatggatccttgttctgggatgacg
gagagggaattgatactgttcagaacaagcgtttcctcttgacgtctttctctgtgtctt
cgggtgttcttaccagcgcagttctcacagatggtctggccgaggccgacaggttgaccc
tgggtgtcgtgaaggtgtggggtgtgtcagcgcccgtcactcaagttatcatgaaagtga
ctggaaagcccgatgccaaattggaattcacgtataacgctgaggttcaggagctgcagt
ttgatgcaacatcacagtctcacaccatcgagaagcctttcaccatcacctggagctcag
cttag

DBGET integrated database retrieval system