KEGG   Sinocyclocheilus grahami: 107570904Help
Entry
107570904         CDS       T04918                                 

Definition
(RefSeq) caspase-1-A-like
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04217  Necroptosis
sgh04621  NOD-like receptor signaling pathway
sgh04623  Cytosolic DNA-sensing pathway
sgh04625  C-type lectin receptor signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107570904
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107570904
   04623 Cytosolic DNA-sensing pathway
    107570904
   04625 C-type lectin receptor signaling pathway
    107570904
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107570904
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sgh01002]
    107570904
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107570904
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     107570904
Peptidases and inhibitors [BR:sgh01002]
 Cysteine peptidases
  Family C14: caspase family
   107570904
Membrane trafficking [BR:sgh04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    107570904
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 PYRIN DUF1491
Motif
Other DBs
NCBI-GeneID: 107570904
NCBI-ProteinID: XP_016112666
LinkDB All DBs
Position
Unknown
AA seq 385 aa AA seqDB search
MDITKKSVFKALEQLEEEEFNQFKWHLWNGVIKDISPISRGKLEKIKCHGVVDLMVQKYS
ADAGKIAVQVLRNMEQNELAHRLELNFQKVQQSVQEEARNAPESMQPIQSDWLRAYNITA
CSQQFKQRLLREKGNDVYMPTSRSQRKGSALLITNIKFDSKEDCRDGAEKDEENMEWLLS
ALGYSVEKHTNLSGNEIDGKVKNFSKRYEHRDADSTFVVIMSHGERIQNKDAILGVHYDP
DLHPDDYFFVEDIFTHLNSVNCPALIDKPKVILIQACRGGDDGGVYVPDRVPASDAWVHK
EKDFVCFMSSLPDTVSYRDPDNGSYLIMYIVDVFSTCAHNDDIMELFRKVASRMENDPRF
TEEEKLLPCIERMSLVRKFYLFPGL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggacatcactaaaaaaagtgtgtttaaagcacttgagcaacttgaggaagaagagttc
aatcaattcaaatggcacttgtggaatggtgtaataaaagacatcagtcctatttctcga
ggaaaacttgagaaaattaagtgccatggtgtggtggatctcatggtacagaagtacagt
gctgatgctgggaaaatcgcagtccaagtgctacgcaacatggaacaaaatgaacttgca
catcgccttgagttaaattttcagaaagttcagcagtctgtgcaggaggaagcaagaaat
gctccagagtctatgcagcccatccagtccgactggctcagagcatacaacattactgca
tgcagccaacagtttaaacagagacttctcagagaaaagggaaatgatgtttatatgcca
acgagcaggtctcagaggaaaggctcagctctgctgatcaccaacattaaatttgacagt
aaagaggactgcagggatggcgcagagaaagatgaggagaacatggagtggctgctgagc
gctctgggttacagtgttgagaaacacacaaatctctctggaaacgaaatagatggaaaa
gtcaagaacttctctaaacgttatgaacatcgagacgcagacagcacctttgtggtcatc
atgtctcatggggaaagaatccaaaataaagatgccattttaggtgtccattatgatcca
gatctacaccccgatgattacttctttgttgaggacatcttcacccatctgaactcagtc
aattgtccggctctgattgataaaccaaaggttattctcattcaggcctgcagaggaggt
gacgatggaggtgtgtatgttcctgatcgagtgcctgcatcagacgcctgggttcacaag
gagaaagactttgtctgctttatgtccagcctccctgatactgtatcgtacagggatcct
gacaatgggagttatttaatcatgtacatcgtggatgtgttcagtacatgcgctcataat
gatgacatcatggagttgttcaggaaggttgcctcacgcatggagaatgacccacgtttc
acagaagaagagaaactattgccttgtattgaaaggatgtcccttgtgaggaaattctac
ctgttccctggactctaa

DBGET integrated database retrieval system