KEGG   Sinocyclocheilus grahami: 107572933
Entry
107572933         CDS       T04918                                 

Definition
(RefSeq) kit ligand-like
  KO
K05461  KIT ligand
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107572933
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107572933
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107572933
Cytokines and growth factors [BR:sgh04052]
 Growth factors
  Growth factors (RTK binding)
   107572933
SSDB
Motif
Pfam: SCF TMEM154 DUF3439
Other DBs
NCBI-GeneID: 107572933
NCBI-ProteinID: XP_016114861
UniProt: A0A672R867
LinkDB
Position
Unknown
AA seq 272 aa
MKKSNIWICTCVHLLLYMTVAAYSSEIGNPITDDIKKISLLKQNIPKDYKITLRYIPKEV
SGMCWVKLNVFHLEVSFKGLAQKFGNISSNKDNIGTFVQILQEMRYHIGHGLEDSMLEFD
CHYVNEMWLTAKYFEFVEDFFYTANSSRNAEDCEPPPCPTSTKTTVTTTTTASTTSAQHS
TNEKRNGLPDDPEKGAFLPKVVQSSLMSLLAIPFIAVVVFLLVWKMKSRRNAPQTERSPE
EGPALFSGEEANIPPLDVEISEKNRLNIIMAV
NT seq 819 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaacatttggatatgcacctgtgtccatttattgctgtacatgacagtt
gctgcctattccagtgaaataggaaatcccattacagatgacatcaagaaaatttctttg
ttgaaacagaatattccgaaagactacaagattacgttacgttatatacctaaagaagtg
agtggtatgtgctgggtgaagctaaatgtatttcacttggaggtgagctttaaaggcctg
gcgcagaagtttgggaacatatcctccaataaagataatataggcacttttgttcaaata
ctgcaagagatgcggtatcacattggacatggcttggaggattcaatgctagaatttgat
tgtcactacgtaaatgagatgtggcttacggcaaagtattttgaatttgtggaggacttt
ttctacactgccaattcgtcaagaaatgctgaggattgtgagcccccgccgtgtcccaca
tctacaaaaacaacagtaacgacaactacgacagcgtcgacaacgtcagcgcaacatagt
acaaatgagaaacgtaacggtttgcctgatgaccccgaaaaaggggcattccttccgaaa
gttgtgcagagcagtcttatgtcgctgctcgccatcccgttcatcgcagtggtggtgttt
ctgttggtctggaagatgaaatctagaagaaatgccccacaaactgaacggagtccagaa
gaaggtcccgcccttttctcaggagaggaagccaatatacccccattagatgtggagata
tctgaaaaaaatagattaaatattatcatggcagtgtaa

DBGET integrated database retrieval system