KEGG   Sinocyclocheilus grahami: 107573412
Entry
107573412         CDS       T04918                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A-like isoform X1
  KO
K04291  lysophosphatidic acid receptor 2
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04080  Neuroactive ligand-receptor interaction
sgh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107573412
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107573412
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sgh04030]
    107573412
G protein-coupled receptors [BR:sgh04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    107573412
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 107573412
NCBI-ProteinID: XP_016115333
UniProt: A0A672KD86
LinkDB
Position
Unknown
AA seq 350 aa
MVCHNNANVSFFYNLSKKSISDTWRPKDVVVVSLGLLVCAFVIFANILVMLAIFINRRFH
YPIYYLLGNLAAADLFSGISYLYLMFHTGPWTSKLSIHGWFVRQGLIDTSLTASVINLMA
IALERHQTIFTMQLHSKMTNHRVVLLIVGIWLIAIVLGLVPSMGWSCVCNLQQCSNMAPL
YSRSYLVFWAVLNLLTFTVMVAVYTRIFIYVRRKSHRMSQHTSQAKHKETVVNLMKTVVM
ILGCFVVCWTPGLVLLLLDGLCESCDVLTYEKFFLVLAECNSFMNPIIYSYRDKDMRDTF
KRILCFPCVGSQQEGEHSGAHFNTLEQEVLSESDGTQHDNSVKPPLKRPL
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggtttgccacaacaacgcgaatgtgagtttcttctacaacctcagcaagaagagcatc
agcgacacgtggaggcccaaagacgtggtggtggtgtccctgggcctgctggtctgcgcc
ttcgtcatcttcgccaacatcctggtcatgctggccatcttcatcaaccgcaggttccac
taccccatctactacctgctggggaacctggcggcggccgacctgttctccggcatctcc
tacctgtacctgatgttccacacgggcccctggaccagcaagctctccatccatgggtgg
tttgtgcggcagggtttgatcgacaccagtctgacggcgtccgtcattaatctgatggcc
atcgcgctggagcgccaccagaccatcttcaccatgcagctgcacagtaagatgaccaac
caccgggtggtgctgctgatcgtgggcatctggctcatcgccatagtgctgggtttggtg
ccctctatgggctggagctgcgtctgcaacctccagcagtgctccaacatggcgccgctc
tacagccgcagctacctggtgttctgggccgtgctcaacctgctgaccttcaccgtcatg
gtggccgtctacacgcgcatcttcatctacgtgcgccgcaagagccaccgcatgagccag
cacacctcgcaggccaagcacaaggagaccgtggtcaacctgatgaagaccgtcgtcatg
atcctgggttgtttcgtggtgtgttggacgccggggctggtgctgcttctcctggacggt
ttgtgtgagtcctgcgacgtcctgacctacgagaagttcttcctggtgctggccgagtgc
aactccttcatgaaccccatcatctactcctaccgcgacaaggacatgcgcgacaccttc
aagcgcatcctctgcttcccgtgtgtggggtcgcagcaggagggcgagcactcgggcgcg
cacttcaacaccctcgagcaagaggtactctcagagagcgacgggacccagcacgacaac
agcgtcaaaccgccgctcaagcgcccgctttag

DBGET integrated database retrieval system