KEGG   Sinocyclocheilus grahami: 107573682Help
Entry
107573682         CDS       T04918                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1-B isoform X1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107573682
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107573682
Enzymes [BR:sgh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107573682
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107573682
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107573682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD DUF4537 DUF745
Motif
Other DBs
NCBI-GeneID: 107573682
NCBI-ProteinID: XP_016115611
LinkDB All DBs
Position
Unknown
AA seq 1204 aa AA seqDB search
MEMELDPELEEELGVSLDELRKWIEEQVDSSEAVQQRKAQLEQLQEWVEQREKEVTNMDA
LCSNASESVVQCEALVKEVYSNMGLVYRESSSEDEGGGGANPSEVIEIDDDDDDDVIAVG
CVVPPKKVVTPAKDSAFKEASAALQRTSQQVQNLAQSVNRTAQSSITPAKAVAPPAQSHG
ALAVPAVFMSSGPRNAPTQPNPNLKQDTIKINMTLLGKKRTKTWHRGTLVAIKQVGNNLK
YKVKFENKGKSLLSGNHVAFDYHPTLERLFVGARVVARYKDGNQVWLYAGVVAEMPNSKN
RMRFLIFFDDGYASYVGLPELYPICRPLKKSWDDIEDASCKDFIEEYITSYPNRPMVLLK
PGQIIKTEWEGTWWKSRVEEVDGSLVKMLFLDDKRSEWIYRGSTRLEPMFNLKMNTANSQ
EKKMAGQQRQRPNMGALRTKGPVVQYTSDNSASASSRPVAPQIPPVRPVAPGPPQPSRTE
SPSLKSQMAKKSTGQVALQPRQVVTSDLQPKALIGAVHQTNSSRLFLLQSGPVHMLTPIT
PVPHTLQTTVSTYTSERIPQEPSYQAPNDRLFYLTHNCTPDCLKRIRPTRPNLHRGRNPL
LTPLLYEFRRMTGRRRLNRKMSFHVIYKSPCGLSLRNMAEIQRYLFQTHCDFIFLEMFCL
DPYVLVDRRFQPQRPFYFIRDITGGREDIPLSCVNEIDNTPPPSVAYSKERIPEDGVFIN
TSPDFLVGCDCTDGCRDKSKCSCHQLTLQATGCAPGGQINPNAGYHHKRLEECLPTGIYE
CNKRCRCNPQMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDVAKGSFVCIYAGKILTDD
FADKEGLEMGDEYFANLDHIESVENFKEGYESEAHCSDSEGSGVDMSRVKLPASSQHGKS
TTKMEERNSSITGKSQDDSSEDSDDDKDEESNEDESDSSDDTFVKDTYYSTSSVWRSYTT
RRQAKGIKEESQDSKDGLSVSTGEERKPPPMPEETGKSKVASWLTNQSSTSANQSVKVEG
GMKTEKKEVMTLSDSDDVQTISSGSDDNKEREKKTQAVVKRQVAVKSTRGIALKSHSLMV
KTGGGGAGGGGSGPSHGQGGGGGDSGPKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCS
ANLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKELLCCCGSTECR
GRLL
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
atggagatggagttggatccagagttggaggaggagttaggagtgtctttggacgagctg
cgcaagtggatcgaggagcaggtggacagcagcgaagccgtgcagcagaggaaagctcag
ctggagcagctgcaggaatgggttgagcagagggaaaaggaggttactaatatggatgct
ctttgctctaatgcttcagagtctgtggttcagtgtgaagctctggtgaaggaagtttac
agtaatatgggtctagtgtatcgtgagagcagctcggaggatgagggaggaggcggagca
aacccttctgaggtcattgagattgatgatgatgatgacgacgatgtcattgctgtggga
tgtgtggttcctcccaagaaagttgtcactccagccaaggactcagcgtttaaggaggct
tcagctgctcttcaaagaacatctcagcaggtgcagaacctggcccaatctgtcaacaga
acggcccaatcgagtattacaccagctaaagcagtggcccctcccgcacaatcccatggt
gctctggctgttccagcagtgtttatgtcgtcaggcccaaggaacgcgcccactcaacca
aaccctaatttaaaacaggatactatcaagatcaacatgacacttttgggtaaaaaacga
accaagacgtggcatcgtggaacacttgttgccatcaaacaagtggggaacaatttaaag
tacaaggtgaagtttgagaataaagggaagagtcttctctctgggaaccacgtggcattt
gattaccacccaacactggagagactgtttgttggtgcccgtgttgtcgccaggtacaag
gatggcaatcaagtctggctctatgcaggtgtagttgctgagatgccaaacagcaagaat
cgtatgaggtttctgatcttttttgatgatggttatgcctcatatgtgggcctgcctgag
ctgtacccaatctgcagaccattaaaaaagagctgggatgatattgaggatgcatcatgc
aaagatttcattgaggagtacatcacgtcgtatcccaacagacccatggtgctgctgaag
ccaggacaaatcataaagacggaatgggagggaacgtggtggaaaagccgtgtggaagaa
gtggatggcagccttgtcaaaatgctttttctggatgataagcggagtgagtggatttat
cgtggctcaaccagactagaacctatgtttaatctgaaaatgaacacagctaacagtcaa
gagaagaaaatggctggtcaacaaagacagcggccaaatatgggagcattgaggacaaag
ggacctgtagtgcagtacactagtgacaacagtgcttctgcttccagtcggcctgtagcc
ccacagatcccaccagttcgtccagtggctcccggacccccacagccttcccgcacagag
agtcctagtttaaagagtcaaatggctaaaaagagcactggtcaggttgcactgcagcct
cgtcaggtcgtgacctctgacctccagcccaaagcactgatcggcgctgttcaccaaact
aattcctccaggctctttcttctgcagtctggacctgtgcatatgttgacgccaatcaca
ccagtcccacatactttgcagacaactgtgtcaacctacacaagtgagcgtattcctcag
gagccatcgtaccaggctccgaatgacagacttttctaccttacacacaactgcactcca
gactgtctaaagcgcattcggcccacccgccccaacctgcatcgaggacgcaacccactt
cttactccattgctctatgagtttcgccgcatgactggccgcagacgccttaaccgcaag
atgtcattccatgtcatctacaagtccccgtgtggcttgagtctgagaaatatggcagaa
atccagcgctacctcttccagacacactgtgacttcatcttcttggagatgttctgtctg
gacccctatgtgctggtggaccgtcgattccaaccccagaggccattctacttcatccgg
gacatcacaggcggtcgtgaagacattcccttgtcctgtgtgaatgagatcgacaacact
cctccgcccagtgtggcctacagtaaagagaggatcccagaagatggagtgtttattaac
accagcccagacttcctggtgggctgtgactgcactgacggctgcagagacaaatccaag
tgttcgtgtcatcagctgactctgcaggctacaggatgtgccccaggtgggcagatcaac
cccaacgctggataccatcacaagagactggaagagtgtctccctacagggatatatgaa
tgtaataagcgctgccgctgtaatccgcagatgtgcactaaccgcctggttcagcacggt
ttgcaggtccgactgcaactctttaagacccaaaataagggctggggcattcgttgcctt
gatgacgtagccaagggctcatttgtttgtatctatgcaggtaaaatcctgacagatgac
tttgccgataaagaaggtttggaaatgggtgatgaatactttgccaatctagaccacatt
gagagcgtggagaactttaaggaaggttacgagagtgaggcccactgctccgacagcgag
ggcagcggggtggacatgagcagggttaaactacctgcttcctctcaacacggtaaatcc
accaccaagatggaggagcgtaacagcagcattaccggcaaaagccaagatgattcatct
gaagacagtgatgatgacaaagacgaagagtctaacgaggatgagagcgacagctcagac
gacacatttgtgaaagacacctattactccaccagctcagtgtggaggagctacaccacc
cgcagacaggccaaaggaataaaggaagagagtcaggacagtaaggatggactgagtgtg
tccacaggtgaggagaggaagccacctccgatgccagaggagactgggaagagtaaagtg
gcgtcttggctcaccaaccagtcttccacttctgcaaatcagagcgtcaaggtggaggga
gggatgaagactgagaagaaggaagtaatgaccctctccgacagtgatgatgtgcaaact
ataagctcaggatcagatgacaacaaggagagggagaaaaagactcaggctgtggtgaag
aggcaggtggcggtgaagtccacgcgtggcattgctttgaagtcccacagtctgatggtg
aaaacagggggagggggtgcaggaggaggcgggtcaggcccatctcatggacagggaggt
ggcgggggtgacagtggccctaaaaacacgcgccagttctatgatggggaggaatcctgt
tatatcattgatgccaaactggaggggaacctcggacgctacctcaaccatagctgcagt
gccaatctgttcgtccagaatgtttttgtggatacccatgatctccgcttcccctgggtg
gccttctttgctagcaagcgcatccgagcagggacggagctgacgtgggattataattat
gaagttggcagtgtggagggcaaggagcttctgtgctgctgtggatcaacagaatgcaga
ggacgactgctgtaa

DBGET integrated database retrieval system