KEGG   Sinocyclocheilus grahami: 107573921
Entry
107573921         CDS       T04918                                 

Definition
(RefSeq) transcription factor p65-like
  KO
K04735  transcription factor p65
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04137  Mitophagy - animal
sgh04210  Apoptosis
sgh04218  Cellular senescence
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh04623  Cytosolic DNA-sensing pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04920  Adipocytokine signaling pathway
sgh05132  Salmonella infection
sgh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107573921
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107573921
  09143 Cell growth and death
   04210 Apoptosis
    107573921
   04218 Cellular senescence
    107573921
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107573921
   04621 NOD-like receptor signaling pathway
    107573921
   04622 RIG-I-like receptor signaling pathway
    107573921
   04623 Cytosolic DNA-sensing pathway
    107573921
   04625 C-type lectin receptor signaling pathway
    107573921
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107573921
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107573921
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107573921
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107573921
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    107573921
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 107573921
NCBI-ProteinID: XP_016115864
LinkDB
Position
Unknown
AA seq 537 aa
MDGLFHQWGPSPVAQGPPYVEIIEQPKARGMRFRYKCEGRSAGSIPGEKSNESTKTHPAI
KVHNYSGPLRVRISLVTKNQPYKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQCVK
KKDVGDAVSCRLQTQNNPFNIPEPRIWEEEYDLNAVRLCFQVSITLPSGELFSLEPVVSQ
PIYDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFFQDSWESKGSFSQ
ADVHRQVAIVFRPPPYRWSSIYCCNLVCYSTHTELWVMISACVSCAGSSMPADRRPFSTA
KRTLGISKPTAASSLPAAASAGVSLKPQPSSFFAPAPGQLFAAPAQSSPSCTSDTWKFLQ
SLTGDSQPKAAASAFTQDFPTVNLHDLHDFNSFMASDQTSAEPAAEPIQSTADDDLPEFP
SFSEVQGSDVDNINIEDFQALLVQSGFPGEAGLSLGKPGSSTEPAADHAGNGSTWMSFPP
SIASLIHNESMMESAAPPAPAPGVLDDLEVLNSIDDDRFMSIFTSGHQVGFLSGHPT
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggacggactgtttcaccagtggggaccgtccccggtggcccaaggccctccgtacgtg
gagataatcgagcagccgaaagcacgagggatgcgtttccgctataaatgcgagggtcga
tcggccggcagcatcccaggagagaagagcaacgagtccacaaaaacacaccccgccatc
aaggttcacaactacagcgggccgctgagagtgcgcatctccttggtaaccaagaaccag
ccgtacaagccacacccacacgagctggtgggcaaagactgcaaacacgggtattatgag
gccgacttacaggagcgacggatacacagtttccagaacctgggtattcagtgcgtgaag
aagaaggatgtgggagatgcagtttcctgtcgcctgcagacacagaacaaccccttcaat
atcccggagcccaggatctgggaggaggagtacgatctgaacgcggtgcgcctgtgcttc
caggtgtccatcacgctgcccagcggagagctgttctctctggagcccgtcgtgtctcag
cccatctatgataaccgagctcctaacacagccgagctcaagatctgccgcgtcaacaga
aactccggcagctgccgcggaggagacgagatcttcctgctgtgcgacaaagtgcagaag
gaggacatcgaggtgcgtttcttccaggactcgtgggagagcaagggctcgttctctcag
gctgatgttcaccggcaggtggctatcgtgttccgcccgcctccgtaccgctggagcagc
atttactgctgcaatttagtgtgttactcaacacacacagagctctgggtaatgatcagt
gcgtgtgtttcatgtgcaggatcctccatgcctgcagacagacggccgtttagtaccgct
aaacgaacactaggcatctctaaacccacagccgccagcagcctcccagcagcggcgtct
gcaggtgtgtcgctgaagccgcagccgtcctcgttcttcgctcctgctccgggtcagctg
ttcgccgcgcctgctcagagttcaccgagctgcaccagcgacacctggaagttcctccag
agtctgacgggagactctcagcccaaagctgcggccagcgccttcacgcaggacttcccc
accgtcaacctgcacgacctgcacgacttcaacagcttcatggcatcggatcagacgagc
gccgagcccgccgcggagcccatccagagcaccgccgacgacgatctccccgagtttccc
agcttctcggaagtgcaaggctccgacgtcgacaacatcaacatcgaggatttccaagcg
ctgctggttcagagcgggttccccggggaagcgggactctcgctggggaagccgggaagc
tctacggagccggcggctgatcacgcggggaacggctccacatggatgtccttcccaccc
agcatcgccagcctcatacacaacgagagcatgatggagagcgcggctcctccggctccg
gcccccggcgtcctcgacgacctggaggtgctcaactccatcgacgacgaccgcttcatg
tccatcttcaccagcggccaccaggtcggattcctgtctggacaccccacctaa

DBGET integrated database retrieval system