KEGG   Sinocyclocheilus grahami: 107574010
Entry
107574010         CDS       T04918                                 

Gene name
rela
Definition
(RefSeq) transcription factor p65 isoform X1
  KO
K04735  transcription factor p65
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04137  Mitophagy - animal
sgh04210  Apoptosis
sgh04218  Cellular senescence
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh04623  Cytosolic DNA-sensing pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04920  Adipocytokine signaling pathway
sgh05132  Salmonella infection
sgh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107574010 (rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107574010 (rela)
  09143 Cell growth and death
   04210 Apoptosis
    107574010 (rela)
   04218 Cellular senescence
    107574010 (rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107574010 (rela)
   04621 NOD-like receptor signaling pathway
    107574010 (rela)
   04622 RIG-I-like receptor signaling pathway
    107574010 (rela)
   04623 Cytosolic DNA-sensing pathway
    107574010 (rela)
   04625 C-type lectin receptor signaling pathway
    107574010 (rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107574010 (rela)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107574010 (rela)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107574010 (rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107574010 (rela)
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    107574010 (rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 107574010
NCBI-ProteinID: XP_016115967
LinkDB
Position
Unknown
AA seq 508 aa
MDGLFHQWGASPVAQGPPYVEIIEQPKARGMRFRYKCEGRSAGSIPGEKSNESTKTHPAI
KVHNYSGPLRVRISLVTKNQPYKPHPHELVGKECKHGYYEADLQERRIHSFQNLGIQCVK
KKDVGDAVSCRLQTQNNPFNIPEPRIWEEEYDLNAVRLCFQVSITLPSGELFSLEPVVSQ
PIYDNRAPNTAELKICRVNRSSGSCRGGDEIFLLCDKVQKEDIEVRFFQDSWESKGSFSQ
ADVHRQVAIVLRTPPYRDANLTEPVRVKMQLRRPSDRELSEPLDFQYLPADPDEHHLMEK
RKRTEGMLQNLKLSSIITGSSMPADRRPFSTAKRTLGISKPTAASSLPAAASAGVSSFFT
PGPGQLFAQSPLRLDLPSSSCSGDPWKLLQSVTVDSQPKPPVPPVFSTVNLSDLQDFPPS
SFIPAEPPSAPQDAFPSCSDVDSINTEEFQALLGQSGSAWTSFPPSLLQSESATVLDDLE
VLSSIDDERFMSIFSSTHQTGFLSGHPT
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggacggactgtttcaccagtggggagcgtccccggtggcccaaggccctccgtacgtg
gagataatcgagcagccgaaagcacgagggatgcgtttccgctataaatgcgagggtcga
tccgctggcagcatcccaggagagaagagcaacgagtccacaaaaacacaccccgccatc
aaggtacacaactacagcgggccgctgagagtgcgcatctctctggtgaccaagaaccag
ccgtacaagccacacccacacgagctggtgggcaaagagtgcaaacacgggtattacgag
gcagacttacaggagcggcggatacacagtttccagaacctgggtattcagtgcgtgaag
aagaaggatgtgggagatgcagtttcctgtcgcctgcagacacagaacaaccccttcaat
atcccggagcccaggatctgggaggaggagtacgatctgaacgcggtgcgcctgtgcttc
caggtgtccatcacgctgcccagtggagagctgttctctctggagcccgtcgtgtctcag
cccatctatgataaccgagctcctaacacagccgagctcaagatctgccgcgtcaacagg
agctccggcagctgccgcggaggagacgagatcttcctgctgtgcgacaaagtgcagaag
gaggacatcgaggtgcgtttcttccaggactcgtgggagagcaagggctcgttctctcag
gctgatgttcaccggcaggtggctatcgtgttgcgcacgcctccgtaccgcgacgctaac
ctgacggagccggtgcgtgtgaagatgcagctgcgcaggccgtctgaccgcgagctgagc
gagccgctggacttccagtacctgcccgcagacccggatgagcaccatctgatggagaag
cgcaagagaacagaggggatgctgcagaacctcaaactgagcagcatcatcacaggatcc
tccatgcctgcagacagacggccgtttagtacagctaaacgaacactaggcatctctaaa
cccacagccgccagcagcctcccagcagcggcgtctgcaggtgtgtcctccttcttcact
cctggcccggggcagctgttcgctcagagtccgctcagactggatctgccgagctccagc
tgcagcggcgacccgtggaagctcctgcagagtgtgacggtggactcccagcccaagcct
ccggtccctccggtcttctccacggtgaacctgtcggacctgcaggacttccccccgagc
agcttcatcccggcggagcccccgagcgccccgcaggacgccttccccagctgctccgac
gtggacagcatcaacaccgaggagttccaggcgctgctgggccagagcggctccgcctgg
acgtccttccctcccagcctcctccagagcgagagcgcgactgtcctggacgacctggag
gtgctcagctccatcgacgacgagcgcttcatgtccatcttctccagcacacaccagacg
ggctttctgtccggacaccccacctaa

DBGET integrated database retrieval system