KEGG   Sinocyclocheilus grahami: 107576062Help
Entry
107576062         CDS       T04918                                 

Definition
(RefSeq) probable histone deacetylase 1-B
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04110  Cell cycle
sgh04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    107576062
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107576062
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107576062
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     107576062
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     107576062
   HDAC complexes
    Sin3A-HDAC complex
     107576062
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107576062
  Chromatin remodeling factors
   NuRD complex
    107576062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 107576062
NCBI-ProteinID: XP_016117817
LinkDB All DBs
Position
Unknown
AA seq 349 aa AA seqDB search
GDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFL
RSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVDYPLRDGIDDESYEAIFK
PIMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYMKSFNLPLLMLGGGG
YTIRNVARCWTYETAVALDSTIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNDYLEKI
KQRLFENLRMLPHAPGVQMQAIPEDAVQEDSGDEEDDPDKRISIRAHDKRIACDEEFSDS
EDEGQGGRRNTANYKKPKRVKTEEEKDGEEKKDVKEEEKASEEKMDTKG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ggggatgttgggaattactactatggccagggtcatcccatgaaaccccacagaatccgc
atgacccacaacctcctgctcaactatgggctgtataggaaaatggaaatttatcggccg
cataaagccaatgccgaagaaatgaccaagtatcacagtgatgattatatcaagttcctc
cgttccatccgcccagacaacatgtctgagtacagcaagcagatgcagagatttaatgta
ggagaggattgtcctgtctttgacggcttatttgagttctgtcagctctcagcaggtgga
tctgttgattacccgctcagggatggtatagatgacgagtcctacgaagccatattcaaa
cctatcatggccaaagtgatggagatgtaccagcccagtgctgtggtgctccagtgtggc
gctgactccctgtctggagatagattgggctgctttaacctcaccatcaaaggtcatgcc
aagtgtgtggaatacatgaagagctttaacctgccgctgctcatgctgggaggtggaggc
tacaccatcaggaatgtggcccgctgctggacctatgagacggctgtagcgctagacagc
accattcccaatgagctcccgtacaatgactactttgagtattttggacctgatttcaaa
cttcacatcagcccctccaacatgaccaatcaaaatacaaatgactatctggaaaaaatc
aaacagcgtctgtttgagaatctgcggatgttgcctcatgctccaggggttcagatgcag
gcgatcccagaggatgctgttcaggaagacagcggagatgaggaggatgaccctgacaaa
cgcatctccatccgtgcccacgacaagcggatagcctgcgacgaggagttctcagactct
gaggacgaaggacagggcggccggagaaatacagccaattacaagaagcctaaacgagtg
aagactgaagaagagaaggatggagaagagaagaaagatgtcaaagaagaagagaaggct
tcagaagaaaaaatggacacaaaggggtaa

DBGET integrated database retrieval system