KEGG   Sinocyclocheilus grahami: 107577610Help
Entry
107577610         CDS       T04918                                 

Definition
(RefSeq) NADP-dependent malic enzyme, mitochondrial-like
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00620  Pyruvate metabolism
sgh01100  Metabolic pathways
sgh01200  Carbon metabolism
sgh03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    107577610
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    107577610
Enzymes [BR:sgh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     107577610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-GeneID: 107577610
NCBI-ProteinID: XP_016119151
LinkDB All DBs
Position
Unknown
AA seq 189 aa AA seqDB search
TLLDDPLYIGLKHKRVRGKAYDDLIDEFMQAVTDKYFKGHVCVSQGRGIFASGSPFKKVT
LADGRSFYPGQGNNAYVFPGVALGVIACGVRHISDDIFLTTAEAISDMVTEEHLAEGRLY
PPLKTIREVSFKIAVKIVDHAYKQGIASWYPEPKDKEAFVLSQVYSSDYDSFTLDPYSWP
KDAMKVQNV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
accctcttagatgatcccttgtacatcggcttaaagcacaaaagagtgaggggcaaagca
tacgatgacctcattgatgagttcatgcaagctgtcaccgacaagtattttaaagggcat
gtatgtgtatcacagggaaggggcatatttgccagcggaagcccttttaaaaaggtcact
ttggcagatgggcgcagcttctaccctggccagggaaacaacgcttatgtgtttcccgga
gtagcattgggagtcatcgcctgtggtgttcgtcacatctcagatgacattttccttact
acagcagaggcgatttctgacatggttactgaggagcatctggctgagggcagactgtac
cctcctctgaagaccatcagagaagtgtccttcaaaattgctgttaagattgtggaccat
gcctacaaacagggcattgcctcctggtaccctgaacccaaagataaagaggcctttgtt
ttatcccaagtctatagctctgactacgactccttcactctggatccatacagctggccc
aaggatgccatgaaagttcagaacgtgtag

DBGET integrated database retrieval system