KEGG   Sinocyclocheilus grahami: 107578975Help
Entry
107578975         CDS       T04918                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD1B-A-like
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107578975
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107578975
Enzymes [BR:sgh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107578975
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107578975
   HMT complexes
    COMPASS/SET1 complex
     107578975
    COMPASS/SET1 complex (yeast)
     107578975
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 107578975
NCBI-ProteinID: XP_016120355
LinkDB All DBs
Position
Unknown
AA seq 534 aa AA seqDB search
MEISDDEMPGTPIASGDCAKNIVVNSAMSPMQTIPMPPPGFPPLPHPQAGFPLPLHPLPT
VPHLAGPHPMLHPLHPYPPGMMPIMQMDLMSSLPQWGSVHMSFQMQTQMLSRMAQSQRPY
PYPHFISGAAASAGAAAAAAMQFGSPYLPLSMVGEPAGTVGHGQPWPLPNMPKFNPAVPP
PGYEPQKEDPHKATVDGVLMVIVKELKAIMKRDLNRKMVEVVAFRAFDEWWDKQERSAKA
TLTPVKTGEGKDEEKERAKPKETISSSLLVNWTKVEGLGFEGMGLSIGLHGAIRLPSFKV
KRKQPPEPTSTNDNKRVRPSTPVDDELEDEESERTDLRTDGSRTDGGGSSAKRRPARPLE
LDSEGEEEEETSGKEESSLSDHEEEPVEDASERLSSGMVSTYPHAGIPRTPGRDLTFTPA
FPDSAALSAGLPMHRKASSESLEEKSLFKEPLLSASPQASLQPNNAGSSPFPGPPLPAAS
HQEPPLPPQGSSPSSVETSSPAAPKDLPVPMIDVPVPLDTTPSKRKPGRPKSKK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggagatttccgatgatgagatgcctggcacaccgatcgctagcggggactgtgccaaa
aacattgtggtcaactctgcgatgtctccgatgcagaccattcccatgcccccaccaggg
ttccccccactgccccatccacaggctggcttcccactgccgctgcatcctcttccaact
gtaccacacctggctggcccccatccgatgctacacccattgcacccttatccccctggc
atgatgcccattatgcagatggacctgatgagctccttaccacagtggggcagcgttcac
atgtccttccagatgcaaactcagatgttaagtcgcatggcgcagagccagcggccgtac
ccttaccctcacttcatcagcggggctgctgcaagtgccggtgctgctgccgccgcagcc
atgcagtttggcagcccgtatctgcctctttccatggttggtgaacctgcaggcactgtg
ggtcacgggcaaccctggcccctacccaacatgcccaagttcaaccctgctgttccccct
ccaggctatgagccccaaaaggaagacccacacaaagccactgtggatggagttcttatg
gttatcgtcaaggagctgaaggccatcatgaaaagagatctcaaccgaaagatggtggag
gtggtggctttcagggcatttgatgagtggtgggacaaacaggagcgttcggctaaggct
acgcttacacctgtgaagacaggtgagggcaaagatgaggaaaaagaacgggccaaaccc
aaagagactatatcctctagcttactggtaaactggaccaaggtggagggtctgggcttc
gagggaatgggactcagcataggcctgcacggtgccatccgattaccatccttcaaggtt
aagaggaaacagccccctgagccaacatctaccaatgacaataagagggtgcgaccatcc
acacctgtcgacgatgagctggaagatgaagagtcagaaagaacagatcttcgcacagat
ggttccagaacagatggtggtggttcttctgccaagcgaagaccagccagacctctggag
ctggacagcgaaggcgaggaggaggaggaaacctctggcaaagaggagtcatcgctttca
gaccatgaagaggagccagtggaagatgcctctgagaggttgtcctctggcatggtgagc
acctatccacacgctggtatccctcggactccgggtagagatcttactttcaccccagct
ttccctgactctgctgctttatctgcaggccttcccatgcacaggaaggcctcgtctgag
agcttggaggagaagtctctctttaaagagcctctactcagcgcctctccccaggccagc
ctacagcctaacaatgcaggttcttccccattccctggtcctccccttcctgctgcttca
catcaggaaccacctctgcctccccaaggctcctctccctcttctgttgagacttcctct
cctgctgctccaaaagaccttcctgttccaatgatagatgttcctgtgcccttagatact
actccaagcaagaggaaaccaggacgccccaagtctaaaaag

DBGET integrated database retrieval system