KEGG   Sinocyclocheilus grahami: 107580677Help
Entry
107580677         CDS       T04918                                 

Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107580677
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107580677
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    107580677
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107580677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 107580677
NCBI-ProteinID: XP_016121832
LinkDB All DBs
Position
Unknown
AA seq 124 aa AA seqDB search
MPEPAKSAPKKGSKKAVTKTAAKGGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccagcgaagtctgcgcccaagaagggctccaagaaggccgtcactaagacc
gcagcgaagggaggaaagaagcgcagaaagtccaggaaggagagctacgctatctacgtg
tacaaagtgctgaagcaggttcatcctgacaccgggatctcctccaaggcgatgggcatc
atgaactctttcgttaacgacatcttcgagcgcatcgccggtgagtcgtctcgtctcgct
cactacaacaagcgctccaccatcacctcgagagagatccagaccgccgtgcgtctgctg
ctgcccggagagctggccaaacacgccgtgtctgagggcaccaaggccgtcaccaagtac
accagctccaagtag

DBGET integrated database retrieval system