KEGG   Sinocyclocheilus grahami: 107580747
Entry
107580747         CDS       T04918                                 

Definition
(RefSeq) uncharacterized protein LOC107580747 isoform X1
  KO
K05461  KIT ligand
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107580747
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107580747
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107580747
Cytokines and growth factors [BR:sgh04052]
 Growth factors
  Growth factors (RTK binding)
   107580747
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 107580747
NCBI-ProteinID: XP_016121881
LinkDB
Position
Unknown
AA seq 272 aa
MFHMREVKIGESICVLVLLFSGLVTCSGVFGSPLTDDVATLDILSENIPSDYRIPIRFIT
KDVGGACWLYVNLYHVESSLKTLALKFGNLSTNKVNITIFITMLEGFRFTLDNEELEVTM
QTFECHYRRGKWPTRRYFSHVKEVLTAAGSTLGKFHDCTPPPCQIPAAPPFTPGQSRQQN
GMNGAIHGLLALFIIPSMALLVLSVKMVFRRSGCCVQRMHEVSLNEPHDGAEESRTGPHS
GAAQGDPDSSSSSQQDRHQHNPARTQQPQQGR
NT seq 819 nt   +upstreamnt  +downstreamnt
atgttccacatgagggaggttaagatcggagaaagcatttgtgtattagtgttgcttttt
tctgggcttgtgacctgctcaggtgtttttggaagccctttaacagatgatgtggccacg
ttggacatactgagtgaaaacattcccagtgactacagaatacctattcgcttcatcacc
aaggatgtgggtggagcttgctggctatatgtgaacctgtatcacgtcgaaagcagttta
aaaacattggccctcaagtttggcaatctgtccaccaataaagtgaacatcactattttt
ataacaatgctggagggttttcgtttcactctggacaatgaggagctggaggtgacaatg
caaacattcgagtgccactatagaaggggaaagtggccgactagacgttactttagccat
gttaaagaggttcttacagcggctggatctacacttggcaagtttcatgactgcacacct
cctccttgccagatccccgcagctcctccattcacaccaggtcaaagcagacagcagaac
ggtatgaacggagcgattcacgggctcttggcgctgttcatcatccccagcatggcactt
ctggtcctctctgtcaagatggtattcagaagaagcggctgttgtgtgcaaagaatgcat
gaagtcagcttgaatgagccccacgacggagctgaagaaagcagaactgggccccacagc
ggagctgcgcaaggggaccctgattccagctctagcagccagcaggacaggcaccagcac
aacccagcaaggacacaacaaccacaacaaggccgatga

DBGET integrated database retrieval system