KEGG   Sinocyclocheilus grahami: 107581902
Entry
107581902         CDS       T04918                                 

Definition
(RefSeq) glucocorticoid receptor-like isoform X1
  KO
K05771  glucocorticoid receptor
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107581902
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107581902
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sgh03310]
    107581902
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    107581902
Nuclear receptors [BR:sgh03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   107581902
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 107581902
NCBI-ProteinID: XP_016123066
UniProt: A0A672R5A8
LinkDB
Position
Unknown
AA seq 733 aa
MDRGLKRSSNNAENLTFGDCTERSLLTDIGANASALNTSKDVLNGLSGSDAQRNLSMADP
SLMGRDIQEPDVKAFKPFRMQHQQKVKEPLNIGDNFSLLDESIADLNRGSGIQAPDTFAM
KMEQFSPMEKDRLDFPPYDYPDKETDGNERVIGDNSIDILKDLDLPDSLSDLNEFYVADE
AAFLSSLAVDDALLGESHFLKDTSPVVTGSSAACANVNGTGKRQQMVEASVNMPVIKTEK
DPDFIQLCTPGVIKQENERRSYCQMSGMGGPHSGPTALGDMGRQTYHYGANTASAVSLPD
QKPLFGLFPPLPTLSDGWVRGNGYGDPSGMQRANETVLPSTYPCSRPEVSSSSPSGSVKP
SGNTHKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGWRARQNTDGQHNYLCAGRNDCI
IDKIRRKNCPACRFRKCLQAGMNLEARKYKKLMRLRGHSSSSEQAPPLPDERMCSLVPKA
MPQLVPTMLSLLKAIEPEIIYAGYDSTIPDTSTRLMTTLNRLGGRQVVSAVKWAKALPGF
RNLHLDDQMTLLQCSWLFLMSFGLGWRSYQQCDGGMLCFAPDLVINEERMKLPYMSDQCN
QMLKISNELVRLQVSYDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMSYIKELGKAIVKR
EENSSQNWQRFYQLTKLLDSMQEMVEGLLNFCFYTFVNKSLSVEFPEMLAEIISHQLPKF
KDGSVKPLLFHQK
NT seq 2202 nt   +upstreamnt  +downstreamnt
atggatcgtggactaaaacgcagcagtaacaatgctgagaatttaactttcggggactgt
actgagagaagccttttgactgatattggtgccaatgcgtctgctttaaatacatcaaaa
gatgtcttgaatggactgagtggtagtgacgctcaaagaaacctctctatggcagatcca
tccttaatgggacgtgacatacaagaaccagatgttaaggcattcaaacctttcagaatg
cagcaccagcaaaaggtaaaagagcccctcaacattggggataacttttcactcttggac
gagagcattgcagacttaaatcgtggttctggcatccaggcccctgacacttttgcaatg
aaaatggagcagttttcccccatggagaaagataggctggactttccaccctacgactat
ccagataaggaaacggatggtaatgagagagtgattggagacaactccattgacatccta
aaggatctggacttacctgactccctatctgacctgaatgagttctacgttgctgatgag
gctgcattcctttcctcgttagcagtggatgatgccttgctgggagagagccacttccta
aaggataccagccctgttgtcactggcagcagtgcagcctgtgcaaatgtgaacggcacg
gggaaacggcagcagatggtggaagccagtgtcaacatgccggtcataaagacagagaaa
gacccagactttatccagctgtgtacaccgggtgtcatcaaacaggagaatgagaggcgg
agctactgtcagatgtcagggatgggtgggcctcacagtgggcccaccgctttgggagat
atgggcagacagacataccactacggagccaacaccgcctcagctgtgagtttaccagat
cagaaacctctttttggcctgtttcctcccctacctaccttaagtgatggctgggttcga
ggaaatggatatggagatccgtctggcatgcagagagccaatgagacagtacttccgtcc
acctatccgtgcagcaggcctgaagtgagcagctccagtccatcaggatcagtcaagccc
agcggaaacacccataagatctgcctggtgtgctccgatgaggcctctggatgtcattat
ggggtgctcacctgtggtagctgcaaggttttcttcaaaagagctgtggagggatggaga
gcacgacaaaacacagatgggcagcacaactatctctgcgcaggaaggaacgattgcatc
atcgacaagataagacggaaaaactgcccagcatgccgctttcgcaagtgtcttcaggcc
ggcatgaacttggaagctcggaaatacaagaaactgatgcgattacggggtcattcgtcc
tcaagtgagcaggccccgcctctgcctgatgagcgcatgtgttcgctggtgcccaaagcc
atgccccagctggtgcccaccatgctgtccctgctcaaagccattgagcctgagatcatt
tacgcgggctacgacagcaccatcccagacacctccacccgcctcatgacgacgcttaac
cgtctaggaggccgccaggtcgtctctgccgtcaagtgggccaaagctcttcccggcttc
agaaacctgcacctggatgaccagatgacgctcctgcagtgctcctggctcttcctcatg
tccttcggcttgggctggagatcctaccagcagtgtgacggaggcatgctgtgtttcgct
ccagacctcgtcatcaatgaggagaggatgaaactaccctacatgagtgaccagtgtaac
cagatgctgaagatctccaatgagctggtcaggctgcaggtgtcctacgacgagtatctc
tgcatgaaagtgctcctgctcctcagcacagtaccaaaggacggccttaaaagccaagct
gtgtttgatgaaatccgcatgtcgtacatcaaggagctgggcaaagccattgttaaacga
gaggagaactccagccagaactggcagaggttttaccagctcactaagcttttggattca
atgcaggagatggtggaggggcttctcaacttctgtttctacacatttgtgaataaatct
ctgagcgtggagtttcctgagatgttggcggagatcatcagccatcagctaccaaaattt
aaagacgggagtgtcaagcctcttctgttccatcagaaatga

DBGET integrated database retrieval system