KEGG   Sinocyclocheilus grahami: 107583298Help
Entry
107583298         CDS       T04918                                 

Definition
(RefSeq) importin subunit alpha-1-like
  KO
K15043  importin subunit alpha-1/8
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107583298
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    107583298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm IBB Arm_3 HEAT_EZ V-ATPase_H_C Adaptin_N ParcG
Motif
Other DBs
NCBI-GeneID: 107583298
NCBI-ProteinID: XP_016124962
LinkDB All DBs
Position
Unknown
AA seq 375 aa AA seqDB search
MAAAAENSPRLTQFKNKGKDVTELRRRRIEVNVELRKAKKDEQILKRRNVSSLPDEATSP
LQEKSQNCQSGYLRNVTWTLSNMCRNKNPAPPLDAVKQMLPTLLRLLHHEDKEVLADTCW
AISYLTDGPNERIEVVVETGVVPRLVQLLGSGELSIVTPSLRSIGNIVTGTDDQTQAVIS
AGALSMFPALLRHHKNNIQKEVSWTLSNITAGKDYQIQEVINAGIVPYLVEVLRRGDYKT
QKEAVWAVTNYTSGGTVEQVVYLVQANILEPLLNLLSTKDSKTILVVLDAISNIFLAGEK
IGEVEKLSLMIEEYGGLDKIEALQSHENEMVYKASLNLIEKYFSGEEEEDECVAPEATTD
GYAFQISESQSTFNF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgctgctgagaacagtccacgactcactcagttcaaaaacaaaggaaaagat
gtcaccgagctgaggcgccgaaggatcgaagtcaatgttgagcttcgtaaagcaaagaaa
gacgagcagattttgaaaaggagaaacgtgagcagtctaccggacgaggccacctctcct
cttcaagagaaaagccagaactgtcagtctggttacctgaggaacgtcacctggaccctg
tcaaacatgtgccgcaataagaaccctgcacctcccctggacgccgtgaaacagatgctg
ccaacacttctccgtcttttgcatcatgaagataaggaggtgctggcggacacctgctgg
gcaatctcatacctgaccgatgggcccaatgaaaggatcgaggttgtggtggaaactggc
gtggttcctcgactggtgcagctactgggatcaggcgagctctccattgtgaccccttca
ctgcgttccatcggaaacatcgtcactggtacagatgaccagacccaggcggtgatcagc
gctggcgctctttccatgttccctgctctgctgcgccaccataagaacaacattcaaaag
gaggtgtcctggaccctgtccaacatcacggctggcaaggactatcagattcaggaggtc
atcaatgctggcattgtgccttacctggtggaagttctccgacggggtgactacaagacc
cagaaggaggccgtgtgggcagtgaccaactacaccagcggaggcacagtagagcaagtg
gtttaccttgttcaggccaacatactagaacccttgctgaacctgctctccactaaggac
agcaaaactattcttgtcgtcttggatgcaatcagcaatatctttttggctggtgaaaag
attggtgaggttgaaaagctgtccctgatgattgaggaatatggcggcctggacaaaatc
gaagctttgcaatcccatgaaaatgaaatggtctacaaggcctccctcaacctcattgaa
aagtatttctctggagaggaggaagaggacgaatgcgttgcccccgaagcgacaaccgat
ggctatgcgttccagatcagtgaaagccaaagcactttcaacttctaa

DBGET integrated database retrieval system