KEGG   Sinocyclocheilus grahami: 107583620Help
Entry
107583620         CDS       T04918                                 

Definition
(RefSeq) nesprin-3-like
  KO
K21761  nesprin-3
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107583620
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   LINC complex
    107583620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spectrin AAA_13
Motif
Other DBs
NCBI-GeneID: 107583620
NCBI-ProteinID: XP_016125392
LinkDB All DBs
Position
Unknown
AA seq 1163 aa AA seqDB search
MTQQEQHEFRESLAEALSWMQAVQERLKQNDNTQGPRSALEVRLRETEKIHSSQPEGHVK
MDRVLVASEALLRNGDEEMKNQTLSKLKDIKALWEETSTYIIHCHSRIEWVWLHWSEYLK
AYEEFEMWLEKMHRSLEPLLEMQLGLQEKLWQVDHLRVLHSDIQAQAQFLERLLDEAAGL
FNRTEDPSVDEKAQLGLQDAYDHIRDRAQERLTLAQKIAEEHQQYQRCVDKFQTWLMSKT
EEVSRFSDMEDTTQNRLKALQELNASIAKEELTLQHIENLSEAVKTNTSPAGAEEITKEM
EELRQAWQRLRQALLENQEELQSSLDSESEYSNRCKELWTDLEQLRTLVQNLSSDLESRD
GERTEENMVAQWKTHTGVRNKLIAEEPRVEQLKSRLKELFRFPQDSKSLSDEMLAVVKEY
QSVKGRSFRLSSESEMALRQILQDPLYGFSQWSQVVSQVLEASAEVTDFSQIALLVQHIE
KLLKNSVQLQERLSLLQVKSDLLISVFGQEKADDLLKELSGDVRKRELLHSQLLKRKNRL
QGLISKTKDFSDAYDSIHKKLSSIKERFITTDGLQPDILAKKTQADQLRVIRKDLEDCEA
QIIALETLVSSNPANRTKFERLYADWKLLYKAVRIKVNESEENIAEHESFHDNILNMEKW
LMIMRQKLESFRGSDGEWSINNRQHEAERALGEFPEKELQLHQTEAQGQIVLARTSDEGK
VHIQQDLKRLRETWMTLHTLSLNLYRLLNEHAATGDQDSLLQRTEFLDRWAEGHHQGTAS
NFEVGLAKGDEGTDQHQRSYHGSESTGHPEPERNMEANPDRIRIVLPEGISRPGGSEVWR
REWTYQDQSMDDEVDAVISGSDCKVNRKRTGMDEGDVISSGGLTGEWVEQHKAGSGIEDL
DIKGRDSFLSGIDSDAQKRMQPSQNPPDDIEMGSRGPQYHADMEAQRREFEAWLHKENDK
LTGILNNQRSLSAKELRIRQNTLKGLRANVAWGQSQFQKLMVGRQSKSAEEDMELEELRY
RWMLYKSKLKEAGDLRGLLKNKGVSGQGQEHVRSGKGVSGQGQEHVRSGKLFIEQISVVV
YFWGSCTSPSTSIEMNDSQSSGPSVILESSKLSRAARQWPFVFMSAGSLELEDSPLIKPT
WSVQKDGEGCVLGWGPWPEMLYS
NT seq 3492 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcaagagcagcatgagttcagggaaagtttggcagaagccctttcctggatg
caggccgtccaggagaggcttaagcaaaacgataacacccaaggacccagatcagcgctg
gaggtcaggctccgagaaacagagaaaattcatagctcacagcctgaaggccatgtaaag
atggacagggtgttggtggcttctgaagctctgcttcgaaatggagatgaagagatgaag
aatcagactctttcgaaactcaaagatataaaagcactctgggaggagacgtcaacctac
atcattcattgtcacagtcgtatcgagtgggtgtggctgcactggagtgaatacctgaag
gcctatgaggagtttgagatgtggctggagaagatgcacaggtctctggagcctctgctt
gagatgcagctgggtctccaagagaagctgtggcaggtggatcatctgcgggtccttcac
agtgacattcaagcacaggctcagtttctagagaggcttctggatgaggctgcaggcctg
ttcaaccgcaccgaagaccctagcgtagatgagaaggctcagctgggtcttcaagatgcc
tatgaccacattcgagaccgagcacaggaaagattaacattggcacagaaaatagcagag
gagcaccagcagtaccaacgttgcgttgataaatttcaaacctggctgatgtctaaaaca
gaagaagtcagccgtttcagcgacatggaggatacgacacaaaataggctgaaagccctg
caggaactaaatgctagtatagccaaagaagagctcactctccagcacattgaaaacctg
tctgaagctgtgaagaccaacacgtctccagcaggtgcagaggagatcacaaaagagatg
gaggagttgaggcaggcctggcagaggttacgccaagcactgctggagaatcaagaagag
ctccagagctcactagactctgagagcgagtattcaaaccgttgtaaggagctgtggacg
gacctggagcagcttcgaaccttggtccagaacctcagcagtgatctggaaagcagggat
ggagagagaactgaggaaaatatggtagctcaatggaagacgcacacgggagtgcgcaac
aagctcattgcagaggagcccagggtggaacagctgaaatcccggttgaaagagctattc
cgattcccacaagactccaaaagcctgtctgatgagatgctagcagtggtgaaagagtac
cagagtgtgaaaggcagatcttttaggctgtcctctgagagtgagatggctctccggcag
atactgcaggatcctctgtatggcttcagccaatggagtcaggtggtttctcaggtcctg
gaggcctctgccgaggtgacggatttctcccaaattgctctgctcgtgcagcatatagag
aagttacttaaaaacagcgtgcagctccaggagcgcttgagtttgctccaggtgaagagt
gatctgctcatctcagtttttggccaagagaaagctgacgatctgttgaaagagctcagc
ggggatgtgaggaagagagagttactccacagccagctcctaaagcgcaagaaccgcctg
cagggtttgatatcaaagacgaaggacttttcagatgcctatgactccatacacaaaaaa
ctaagctccataaaggagcggttcatcacgacagatggacttcaacctgacattcttgcc
aagaagacccaggccgaccaactccgggtcattagaaaggacttggaagattgtgaagcc
cagatcatagctctcgagacgctggtttcatccaaccctgcaaacaggacaaagtttgaa
cgtctgtatgcggactggaaattgctttataaggcggttcggattaaggtgaatgaaagt
gaggagaacattgcagaacatgagagtttccatgacaatattctgaatatggagaagtgg
ttaatgatcatgagacagaagctcgagtcgtttcgtggatcagatggggaatggagcatc
aataaccgccagcatgaggctgagagggcgctaggagaatttccagagaaggagcttcag
cttcatcagacagaggctcagggtcagattgtgctggccagaacttctgatgaaggcaaa
gttcacatccagcaagaccttaaacgcctcagagagacctggatgaccctccacacgctt
agtctcaatctttacaggcttctgaatgaacatgcagccacaggcgaccaagattcccta
ttacagagaaccgagttcttggacagatgggcagaagggcatcaccagggaacggcttca
aactttgaagtgggacttgccaaaggagatgagggaacggaccagcatcagagatcctac
catggatcagaatcaacaggccacccagaaccagagaggaacatggaagcaaatccagat
cgaattcgaattgtgcttcctgagggcatctcaagaccaggaggttcagaggtctggaga
agagagtggacttaccaagaccagtccatggatgatgaggtggatgcagtcatatctgga
agtgactgtaaggtgaacaggaagcggactgggatggacgaaggtgacgtgatcagcagt
ggtggtttgactggggaatgggttgaacaacacaaagctggttctggaattgaagacctg
gatataaaaggtagagacagctttttaagtgggattgactctgatgcacagaaaaggatg
cagccgtcacagaacccccctgatgacattgagatgggctctcgggggccccagtatcat
gctgatatggaggctcagaggagggagtttgaagcgtggcttcacaaggaaaatgacaaa
ctcacaggaattctgaacaaccaaagatccttgagtgctaaagaactgaggataagacag
aatacactcaagggtttacgtgccaatgtagcttggggtcagagtcagttccagaagttg
atggtcggtcggcagagtaagtccgcagaggaggacatggaactagaagagctgcgttac
cgctggatgttatacaagtccaaacttaaagaggctggtgacctcagaggtctgctgaaa
aacaagggtgtcagtggacaaggacaggagcatgtccgatctggaaagggtgtcagtgga
caaggacaggagcatgtccgatctggaaagctttttatagaacagatttctgttgttgta
tacttctggggatcctgcaccagcccatcaacttccattgagatgaatgacagccagagt
tcaggcccgtctgtcatacttgagagctcaaagctgtcccgtgcagccaggcagtggcct
tttgtgtttatgagtgctggctctttggagctggaagacagccccctcattaaaccgaca
tggtctgtgcagaaagatggagagggctgtgttcttggctggggcccctggcctgaaatg
ctttatagttaa

DBGET integrated database retrieval system