KEGG   Sinocyclocheilus grahami: 107584093Help
Entry
107584093         CDS       T04918                                 

Definition
(RefSeq) chromobox protein homolog 7-like isoform X1
  KO
K11454  chromobox protein 7
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107584093
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     107584093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chromo CBX7_C PPP4R2 Mtf2_C Pox_Ag35 Ribosomal_L34 NOA36
Motif
Other DBs
NCBI-GeneID: 107584093
NCBI-ProteinID: XP_016126006
LinkDB All DBs
Position
Unknown
AA seq 253 aa AA seqDB search
MELSAIGEQVFAVESILKKRVRKGHVEYLLKWKGWPPKYSTWEPEEHILDPRLVLTYEEK
EQRERSVRWRKRGPKPKRLFVQPHIALLKRNIYAMDLRSAHKDTEKSSVHLPLSLDPRFQ
STGACIYRQLTHHKKKKKASRETSEEEWDRREDDDDDDDIFMEEEEEEEEEEDTRQGGTK
TGSNTLNKRVRRGRWSPTTGSEAMTISPLPEDWSPVMGPEEVIVTDITINSLTVTFREAL
VARGFFRSWEMEI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggaactgtcggcaatcggtgagcaagtgttcgctgtggaatcaatcctaaagaaaaga
gttcgaaagggtcatgtcgaatatttattgaagtggaaggggtggcctcccaagtacagc
acatgggagcctgaggagcacattctagaccctcgactggttttaacgtatgaggaaaaa
gagcagagagaaaggtcagtgaggtggcgtaaaagaggcccaaaaccgaaaagactgttc
gtgcagccacatattgctctcttgaagagaaacatttacgcaatggatctacgcagcgcg
cacaaagatacagagaagtcttcagtacatctgccgctctcgcttgacccaaggttccag
tccacaggggcttgtatatatcgacaattaacccaccacaagaaaaagaagaaagcttcc
cgagagacttctgaggaagaatgggatagaagagaagatgatgatgatgatgatgatata
tttatggaggaggaggaagaagaagaagaagaagaggacacaagacaaggaggaactaaa
actggcagcaacactttaaacaagcgtgtcaggagaggtcgctggagtccaaccactggg
tcagaggcaatgactatatctcctttacctgaagactggagtccagttatgggcccagag
gaggtcattgtgacagatatcaccatcaactcactgactgtgacttttagagaggccttg
gtagcaagggggttcttcaggagctgggagatggagatctga

DBGET integrated database retrieval system