KEGG   Sinocyclocheilus grahami: 107584710
Entry
107584710         CDS       T04918                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
sgh04115  p53 signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04371  Apelin signaling pathway
sgh04510  Focal adhesion
sgh04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107584710
   04340 Hedgehog signaling pathway
    107584710
   04371 Apelin signaling pathway
    107584710
   04068 FoxO signaling pathway
    107584710
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107584710
   04115 p53 signaling pathway
    107584710
   04218 Cellular senescence
    107584710
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107584710
   04530 Tight junction
    107584710
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107584710
NCBI-ProteinID: XP_016126903
UniProt: A0A672M298
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLFCCEVDTIRRAYQDSNLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTKKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVRPSELLQMELLALNKLKWDLASVTPHDFIEHFLAKLPIHQSSKQILRK
HAQTFVALCATDVNFIASPPSMIAAGSVAAAVQGLYLKSSDSCLSSQNLTSFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHNISTETKRVEEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacaccagttgttttgctgtgaagtggataccattagaagagcttaccaagatagc
aacctgttgaatgaccgagttttacagacaatgctcaaagcagaggaaaactatcttcca
tctccaaattatttcaagtgtgtgcagaaagaaattgtacctaaaatgaggaaaatcgtc
gccacatggatgctcgaggtctgtgaagagcagaaatgcgaagaggaagtttttccgttg
gctatgaactacctggacagatttttatctgtggagcccaccaaaaagaccagattacag
ctgttaggagcaacttgtatgtttttggcctctaagatgaaagagactgtgccactaaca
gcagagaagttgtgcatatacacggacaactccgtccgtcccagcgaattattgcaaatg
gaactgctggcgctaaataaactgaaatgggatctggcctcagtgacaccacatgatttc
attgaacatttcctcgccaaactgcctatacatcagagctccaagcagatactgcgcaag
cacgcccagacgtttgtggccctctgtgcaacagatgtcaacttcatcgcaagccctcca
tccatgattgcggccggcagcgttgcagcagcagtgcaggggttgtacctcaaaagcagc
gacagttgcctctcgtcccagaacctcaccagcttcctctcacaagtcatcagaagcgac
cctgactgtctgcgatcgtgtcaggaacagatcgagtccctgctggaatctagtctcaga
caagctcagcagcacaacatctccacagagaccaaaagagtggaggaggacgtggacctc
tcttgcactcccacagatgtcagagacattaatatctga

DBGET integrated database retrieval system