KEGG   Sinocyclocheilus grahami: 107586154
Entry
107586154         CDS       T04918                                 

Definition
(RefSeq) erythropoietin-like isoform X1
  KO
K05437  erythropoietin
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107586154
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107586154
Cytokines and growth factors [BR:sgh04052]
 Cytokines
  CSF and other factors
   107586154
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 107586154
NCBI-ProteinID: XP_016128893
UniProt: A0A672S3F7
LinkDB
Position
Unknown
AA seq 186 aa
MQTFSGLVSVLIVFVWLGGNQVSPLRPICDLRVLEHFVREARDSEVIMRGCRGGCGAMKS
YFVPLTSVDFAFWEHIDVHEQAVEVQTGLSLLVQALSTAMKAVSNSRLANALDNNISNIH
SLSQILHSLDLQQARSTVLSDDSAPASTQSQEVSSLPELLQVQSSFLRGKVRLLLSAAPA
CQRQNS
NT seq 561 nt   +upstreamnt  +downstreamnt
atgcaaacattttcaggtctggtgtcggttttgatagtgtttgtgtggctgggtggaaac
caggtctctcccctccgacccatctgtgacctgagggttctggaacactttgtacgagaa
gctcgagattctgaagtcatcatgcgaggttgcagaggaggctgtggagcgatgaaatcc
tactttgtaccgctgactagtgttgactttgctttttgggaacatatagacgttcatgag
caggccgtggaggtccagactggactgtctctgctggttcaggccctgagtacagcaatg
aaagcagtgagcaactctcgtctggccaatgcactggataacaacatcagtaacatccac
agcctcagccagatcctgcacagtcttgatttacagcaggccagatccacagttctttca
gatgattcagctcctgccagcacacagtcgcaggaggtctcctctctcccagaacttctg
caggtgcagagcagtttcctgcgtgggaaagtcagactcctgctttcagctgcaccagcc
tgccaacggcaaaacagctga

DBGET integrated database retrieval system