KEGG   Sinocyclocheilus grahami: 107586175Help
Entry
107586175         CDS       T04918                                 

Definition
(RefSeq) histone-lysine N-methyltransferase NSD3-like
  KO
K11425  histone-lysine N-methyltransferase NSD3 [EC:2.1.1.43]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107586175
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107586175
Enzymes [BR:sgh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107586175
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107586175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET PWWP AWS
Motif
Other DBs
NCBI-GeneID: 107586175
NCBI-ProteinID: XP_016128931
LinkDB All DBs
Position
Unknown
AA seq 293 aa AA seqDB search
MCRWWPAEICNPRLVPSNIQSLKHDIGDFPVFFFGSHDYYWINQGRVFPYVESDKNFAEG
QVGINKTFKKALEEAAKRFQELKAQRETKEALEQERNSRRPPPYKLIKSNKPVGKVQVHV
ADLSEIPRCSCRPTDERPCSQDSQCLNRMLQYECHPQVCPAGDCCHNQCFSKRLYPDTEV
IKTTGRGWGLKTKQDLRKGDFVMEYVGELIDSEECKQRIRHANENDVTNFYMLTLTKDRV
IDAGPKGNLSRFMNHSCSPNCETQKWTVNGDVRIGLFTLCDIAAGDDDFILPV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaggtggtggccagctgagatatgcaaccctcgcctggttccctccaacatccag
agcctgaagcatgacattggtgactttccagtctttttctttggctcccatgactattac
tggataaaccagggaagagttttcccatatgttgagagtgataagaactttgcagaggga
caagttggcatcaataagacgtttaaaaaagcacttgaggaggcagcaaaaaggttccag
gagctaaaagcacagcgagaaactaaggaggccctcgaacaggagcgcaactctcgcaga
cccccaccatacaaacttatcaagtccaataagccagttgggaaggtgcaggtgcacgtc
gctgacctctcagagatcccacgctgcagctgcagaccaacagatgagcgtccgtgcagc
caggactctcagtgcctgaaccgcatgctgcagtatgaatgccacccgcaggtctgtccg
gcaggtgactgctgccacaaccagtgcttttccaaacgcctctaccccgacactgaggtc
attaagaccaccggccgaggatggggcctaaagaccaagcaggacctcagaaagggtgat
tttgtcatggagtatgttggcgaactgatcgactccgaagagtgcaagcagcgaataaga
catgccaatgagaacgatgtgaccaacttttacatgctgaccctcacaaaggaccgtgtg
attgatgctggacccaaagggaacttgtcacgctttatgaaccacagctgcagtcctaac
tgtgagactcagaagtggacagtgaatggagatgtgcggatagggctctttaccttgtgt
gatatcgctgcaggtgacgatgactttattttacctgtgtaa

DBGET integrated database retrieval system