KEGG   Sinocyclocheilus grahami: 107586927
Entry
107586927         CDS       T04918                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
sgh  Sinocyclocheilus grahami
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 Ras_bdg_2 C1_2
Other DBs
NCBI-GeneID: 107586927
NCBI-ProteinID: XP_016129972
UniProt: A0A672NLQ9
LinkDB
Position
Unknown
AA seq 361 aa
MAKCELIELQDLTPDDRIELAPPSGPPARDGPTLERWSKEKVVRMVGERVRLEDPDWLTC
KPGWGHEFQPCRQTQLSWCDLCGEFIWGLYHQSLRCTHCNYTCHYRCQPFIQLDCSLNCD
AVSKQLNYCEDTIETDTNVDEPVDCRKQELSLSEIQQKVKEYNAQVNSNLFMVLNRDGSY
TGFIKVQFKLARPVSLPPPRSTSSSSGRDGDCQEDKALKHHTSFYLPRDTVKHLHISSST
RAREVIEALLKKFTVVDNPAKFSLFERSERQNQVYLRKLADGEHPLFLRLCAGPNEQVLS
LVLKENETGEVNWDAFSFPELQNFLRILKREEEDHVRQIVRRYTLARDKMKEALKNFSTP
G
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggcaaaatgtgagcttattgaactgcaggacttgactccagatgaccgcatcgagtta
gcaccccctagcggccctccggcccgcgatgggcccactctagaaaggtggagcaaagag
aaggtggtgcggatggtgggggagcgcgtgcgtctggaggaccccgactggctgacgtgt
aaaccgggatggggacatgaattccagccctgcagacagacgcagctgagctggtgcgac
ctctgcggagagttcatctggggcctgtaccaccagagcctccgctgcacacactgtaat
tacacttgtcactaccgctgtcaacccttcattcaactggactgcagcttgaactgcgac
gccgtcagcaaacagctaaactactgcgaggacacgatcgagacggacactaatgtggat
gagccagtggactgcaggaaacaggagctgtccctcagtgaaatacaacagaaagtgaaa
gaatacaatgctcaggtcaacagtaacctcttcatggttctgaaccgtgatggatcgtac
actggcttcataaaggtccagttcaagctggcccggcccgtgtctctccctcctccacgg
agcacgtcctcctcctcgggacgggatggcgattgtcaggaagacaaagcactgaagcac
cacacctcattctacctgcccagagacacggtcaaacacctgcacatcagctccagcacg
cgggccagagaggtcatcgaagccctgctgaagaaattcactgtggtggacaatccggcc
aagttctcactgtttgaacgcagtgaacgacagaatcaagtgtacttaaggaagttagca
gatggcgaacatccgcttttcctgcgcctgtgtgctggacccaacgagcaagtcctcagt
ttagtccttaaagagaatgaaacgggggaagttaattgggatgcgttcagttttcctgaa
ctccagaacttcctgcgcatcctgaagcgggaggaggaggatcacgtgcggcagatcgtg
cggcgctacactctggccagagacaagatgaaagaagctctgaagaacttcagcacgccg
ggctga

DBGET integrated database retrieval system