KEGG   Sinocyclocheilus grahami: 107587320Help
Entry
107587320         CDS       T04918                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04141  Protein processing in endoplasmic reticulum
sgh04210  Apoptosis
sgh04217  Necroptosis
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh04920  Adipocytokine signaling pathway
sgh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107587320
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107587320
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107587320
   04217 Necroptosis
    107587320
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107587320
   04622 RIG-I-like receptor signaling pathway
    107587320
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107587320
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107587320
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sgh03019]
    107587320
   04121 Ubiquitin system [BR:sgh04121]
    107587320
Enzymes [BR:sgh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107587320
Messenger RNA biogenesis [BR:sgh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     107587320
Ubiquitin system [BR:sgh04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    107587320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-RING_5 zf-RING_UBOX zf-C3HC4_3 zf-RING_2 Sina MATH zf_C2HC_14 zf-TRAF_2 ATG16 zf-RING_6 DASH_Dad3 DEC-1_N zf-ACC Spc7
Motif
Other DBs
NCBI-GeneID: 107587320
NCBI-ProteinID: XP_016130528
LinkDB All DBs
Position
Unknown
AA seq 574 aa AA seqDB search
MAAQEPSPPSSLEGNKPGFPKKILANKLEDKHLCNICLKILRRPFQAQCGHRFCSYCFNK
AVSSGPQKCSACIKEDIFEEPTSILKQGCAFPDNAAKREVEALEAVCINEECSWTGTIKE
YEANHEGKCDFRILPCPSCKELLRANELERHNERECPERTLNCKYCKEPFHFKNIKAHDE
ICPKYPMICEGCAKKKIPREKYVDHIKLCTKFRTPCRFHVVGCDMTVEKEKIHDHEQACS
YKHLNLLLHFIMGIKVNLESLQPQSLELASHKVHELHQSLRELEQKMGQLSGAGAPVQGA
CALLPPPPAPTLGTSFTPLPTAVGAALELQLHSEKTKVAELSRRCQELELKVSTFENIVC
VLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEAKMREMSA
ATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHL
SLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDISSSSFQRPVSDMNIAS
GCPLFCPLSKLDTKNSYIRDDTIFIKAIVDLTGL
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggctgcacaggaaccctcaccaccatcttcattagaaggcaacaaacctggcttcccc
aagaaaatactcgccaacaagctggaggacaagcatctgtgcaatatctgtctgaaaatc
cttaggagaccgtttcaggcgcagtgcggacatcgtttctgttcttattgttttaataaa
gcagtgagctccggaccacagaaatgcagtgcctgtataaaggaggacatatttgaagaa
ccaacatcaattttgaaacagggctgtgcttttcctgataatgctgccaaaagagaagtt
gaagctcttgaagctgtttgcatcaatgaggaatgcagctggacaggcaccattaaagaa
tatgaggcaaaccatgagggaaagtgtgacttcaggatccttccctgcccatcatgcaaa
gaacttctaagagccaacgaacttgaacgtcacaatgagagagaatgcccagaaaggact
cttaattgtaaatactgcaaggagccattccattttaaaaacattaaggcccatgatgag
atatgccctaaatatcccatgatttgtgaaggttgtgccaagaaaaaaattcccagagag
aaatatgtggaccacattaaactgtgcaccaaattccgaacaccttgcagatttcacgtt
gtaggctgtgatatgacggtggaaaaggagaagatccatgaccatgagcaagcctgttcc
tacaagcacttaaacctcctattgcacttcatcatgggcatcaaggtgaacttggagagt
ctgcagcctcagagtctggaactggccagccataaggtccacgagctgcatcagtctctg
cgggagctggagcagaagatgggccagctgagtggagcaggggctcccgtgcagggggcc
tgtgcgctactgccgccaccgcctgctccgacgctcggtacgtctttcaccccactccct
acagccgttggggcagccttggagctgcagctacacagtgagaagaccaaagtggcggag
ctcagccgccgctgtcaggagctggagctgaaggtaagcacctttgagaacattgtctgc
gtgctcaaccgtgagatggagcgctccgccaccaccatggaggcctataaccgtcagcac
cggcttgaccaggacaagattgagatactcaacaacaaggtacggcagttggagaggaca
gtaggccttagggatctctccatcgtggagatggaggcaaagatgagggagatgtccgct
gccacttacgatggcgtgtttgtgtggaagatctccgacttctcgaagaagagacaagat
gctgtagccggacgggcacctgctatgttctcgcctgcattttacacaagcaaatatggc
tataagatgtgtttgcgcatctatctgaatggggatgggacgggacgtggtacacacttg
tctctgttcttcgtggtgatgaggggacacagtgatgccttgcttaagtggcctttcaat
cagaaggtcaccctcatgttgctggatcagaacaacagggagcacatcatcgatgccttc
cggccagatatttcctcttcctccttccagaggcctgtgagtgacatgaacattgccagc
ggctgccctctcttctgccctctctccaaactagacaccaagaactcctacatccgagat
gacaccatcttcatcaaggccattgttgacctcacaggcctttaa

DBGET integrated database retrieval system