KEGG   Sinocyclocheilus grahami: 107587950
Entry
107587950         CDS       T04918                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04080  Neuroactive ligand-receptor interaction
sgh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107587950
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107587950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sgh04030]
    107587950
G protein-coupled receptors [BR:sgh04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    107587950
SSDB
Motif
Pfam: 7tm_1 DUF4752 TMEM192
Other DBs
NCBI-GeneID: 107587950
NCBI-ProteinID: XP_016131413
UniProt: A0A672MTF7
LinkDB
Position
Unknown
AA seq 358 aa
MLFNSTCEAYDNPVSFFYNKTGKPISPNWRPHDFIVVGLGLPICVFIILANMLVIVAIII
NRQFHFPIYYLLGNMAAADLFAGISYLYLVFHTGPWTIGLTIKEWFIRGALINMSLTASV
VNLLAVAVERHQTIFTMQLHSTMTRRRVVMLIVTIWLVAVVMGLVPTMGWNCVCDLSTCC
MVAPLYSRSFLVSWAILNLMAFFIMVAVYTHIFIYVRRRSRVMSPHTDQPSNNQTVISLM
KTMSMILGAFVICWTPGLVILLLDGLSCSECQVLKYEKYCLVLAECNSLVNPIIYSFRDE
DMRTTYKRILCFPWRRMRQHEGPSGIRFEPVKTGAPSEKNSNNSTSLEPSSPQSLLSL
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgttattcaattctacctgtgaggcttatgacaatccagtgtccttcttctacaacaag
actggcaagcccatcagcccgaactggcgccctcatgactttattgtggtcggcctcggg
ctcccgatttgtgtctttattattctggcgaatatgttggtcatagtggccataatcatc
aaccgacagttccactttcccatttattacttacttgggaacatggcggccgcggacctc
tttgctggaatatcgtatctctacctggtgttccacacggggccgtggaccatcggtttg
accatcaaagagtggtttattcgcggagctttgatcaacatgagcctgaccgcgtctgtg
gtcaacctgctggcggtggcagtggagcgccatcagaccatcttcaccatgcagctccac
agcaccatgaccaggaggcgcgtggtgatgctgatagtcaccatctggttggtggccgtc
gtcatgggtttggtgcccaccatgggctggaactgtgtttgtgacctgtcaacctgctgc
atggttgcgccgctgtattcccgcagcttcctagtgtcctgggccatcctcaacctcatg
gccttcttcatcatggtggccgtttacactcacatcttcatctacgttcgccggcggagc
cgagtaatgtccccacacacggatcagccctccaacaatcagactgttatcagcctcatg
aagaccatgtccatgattctgggtgcctttgtgatctgttggacaccgggtctggtgatt
ctgttactggacggtctcagctgcagtgaatgtcaggttcttaaatatgaaaagtactgc
ctggttctggctgagtgtaactctctagtgaaccccatcatctactcgttccgggacgag
gacatgaggaccacctacaaacgcattctctgcttcccttggagaagaatgcgccagcac
gaggggccttctggcatccgctttgagcctgtgaaaacaggggcaccctcggagaaaaac
agcaataactccaccagtttagagcccagttcaccacaaagcctattgtctttatag

DBGET integrated database retrieval system