KEGG   Sinocyclocheilus grahami: 107588417Help
Entry
107588417         CDS       T04918                                 

Definition
(RefSeq) protein TASOR-like isoform X1
  KO
K21873  protein TASOR
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107588417
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107588417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3715
Motif
Other DBs
NCBI-GeneID: 107588417
NCBI-ProteinID: XP_016131972
LinkDB All DBs
Position
Unknown
AA seq 1618 aa AA seqDB search
MEKRRELKHDGRTEKELSETFCFLLCDAQKVSVVCERGLSVGNSWMSMLGNPSKGVYLCQ
FSDLLQISPIEPGFTGNIIIFKVIKGKVKSVHDSMSKSMDPTPKFDSHFSKNSTRVTSLQ
SYRAFEYTQQYFYEYVDFEVSSRPRHLCPYAVVSFYFKGKEASTAAPKPLPPLRSNSQPS
GTSKGRRCYTVWRGHFVNGGKDVYQASLRSLSQPFLPYKLPEKIEIGKVMSLQQVKQKIP
SALFSWSLYTGSHEVSKSGMFCSLFDVVEKERTSPKSLIALLQKLEEEGLVLVNMVKDRG
FLFLLSASQMDNSSERRGGWKMSSIQALFIYREKRDWLKSASESCRAVSSEHHSPIMPQH
DWFMSALHCALSKARGEPPADLSATVEQQVYDYLTHLREGKPLQRGRTDYDPKLDTREKL
FPAPRKKTNWESFVRPYIYKPAMFTMLLESVKEKVEELRGQPEGAAPHNDPGKVQELLKL
IQRNKKSSKGEEGDPEPAEDACALKRKLDLDAHEGSSKRQRNQPSAELREADDRQSTPSL
TNLLSSVGLQDTDLRKNKTQLGALKIMEILDRFGKPSLDTDLRRGKRQGALEVLRMIDTL
TRGAAESPEDTAATDISDSALFDSMSRLGLPTDRDIDLRERFVEEEPERSDCLEKKRATG
FVEKTQVKRGREETAGSLSSLEAFSPCSDSGGQQRGVNLLGEKTIPWVLIPITGLKMERY
SQRQMDYPEDPRFVQSPTVSTHAMPDTKDLSPPYQPDSSSTAVDLNVQTAAEVEDEEPVA
PAVAIECPADGSGFDHIVDELVSGFSSEVEQLLRAKRIYYVACSSTQGSREPLQTPAVPL
SNYVSNYNTPFPVSSYMSSFHNSLMMFIDPQHVSRYPGAQEDVTSSSSAAEVPSDVPDTS
SSFNPCASSSSNNTFESSLTPCSPSSALPEPMTQPQHHSSLPDPDLQQTPQQMWALEQDS
VNQKMQEANVPHDLHEVNGSLVAETTGAVEGQTDASIGHAHSAISSIIDQLQPEVISNLV
EIIKGVQKNIVYFYIHSTDEEESDVCWEIKEYLIKLGNLECSPHGFLEKSSSQDKLLVII
QNMDIAAQVHKIPSLVSLKKHPSVSFAGVDNLSDIQNHTYNELFQSGGFIVSDEHVLSPA
VITADKLQDILEYIEQLNSPQSPWRWRVHFKSHKKLREHSRLKPDALKLFEILNEYEKRH
IVEILSYHDCDTPSRQAPDLDCLVDLQARFIKQRHMIFLTGCQFEMFPHYSSSGIVIANV
DDIKCIISSLAAGGSVDSAPSAEACGSPAPASLRDDSMSLDSDLDSPDNPVLVSVCVVPD
QCPLAEPSLQDQAKPIPVITTTSETPKPIDFVALSEAISQFKTSRMLSKSDAGETLQTSF
GVDPHQSFLSHSGLSDSYPQCSWENHSMSNTRPETPVQAEAAGAPLSSSSPVEASRELVQ
LGETAAESSILNMSKAWEQSSTSSTVTANAGQMSTESGVSETPAVSSASSSEAAVTHGSR
PGSSGQGFYPPLQGFTAGPSFISHNAAVGLRHPLLNCTVPNSLGVVGAPVFTGFLPNPSM
QMSWSGGLAQGSAPGLWGPHYGVDMQQIHGSPFLQTWQGNSAFQGDAYHPNRGGFGGW
NT seq 4857 nt NT seq  +upstreamnt  +downstreamnt
atggagaagcgaagggagctcaagcatgatgggcgcacagagaaagagctgtccgagacg
ttctgcttcctgctttgtgatgcccaaaaggtctcggtggtgtgtgagagaggactgtct
gttggcaacagctggatgagtatgttggggaatccatcaaaaggtgtttacctgtgtcag
ttttctgatttacttcaaatcagccccattgagcctggatttacaggaaacatcatcata
tttaaagttataaagggtaaagtgaagagtgtacatgactccatgtccaaaagtatggat
cctacacctaaatttgacagtcatttctccaagaactcaaccagagttacgtctttacag
tcgtacagggcattcgagtacacgcagcaatacttttacgagtatgtggattttgaggtt
tcgtccaggccgagacacttgtgtccgtatgcggtggtctctttttactttaaaggcaaa
gaggcttcaacagcggcccccaaaccgctgcctcctctcaggtccaacagtcagccatca
gggacgagcaaaggtaggcgctgttacacggtatggcgagggcattttgtgaatggggga
aaagacgtgtaccaggccagccttcgatcgctctctcaacctttcctgccctacaaactg
ccagagaagattgagatcggtaaagtcatgagcctgcagcaggtcaagcagaagatcccg
tctgccctcttctcctggagcctctacacgggcagccatgaagtgtctaaaagtggcatg
ttctgcagtctgtttgacgtggtggagaaagagcgaacttctccgaagagcttgatcgca
ttgctgcagaaactggaggaggagggtctggtgctggtgaatatggtgaaggacagaggt
tttctcttcttgctttctgccagtcaaatggacaactcaagcgagcgacgaggcggttgg
aaaatgtcctctatacaagcactttttatttaccgtgagaagcgtgactggttgaagagc
gcatcggagagctgtagagctgtgtcgtcagagcatcacagtcccatcatgccccagcac
gactggttcatgtccgctctccactgcgctctgagcaaggctcgcggcgagcctcctgct
gacctcagcgccaccgtagagcagcaggtttacgactacctcactcacctccgcgagggc
aagcccctgcagcgcggccgcaccgactacgaccccaaactggacaccagggagaagctg
tttcccgcgccccggaagaagaccaactgggagagcttcgtgcggccctacatctacaag
cctgccatgttcaccatgcttctggagagcgtgaaggagaaggtggaggagctgcggggt
cagcctgagggagcagcccctcataatgacccgggcaaagtccaggagctgctgaagctc
atccagaggaacaagaagagctcgaagggagaggagggagatccagagccggcagaggac
gcctgcgcgctgaagaggaagctggatctcgacgctcatgagggaagctcaaaacgccag
agaaatcagcccagcgcagaattaagagaagcggacgacagacagtccactccatctctg
actaatcttctgagcagcgtcggtcttcaggacacagacctgagaaaaaacaagactcag
ctgggagcgctgaagatcatggagatcctggaccgcttcggaaagcccagtcttgacacg
gacctgcgcagaggcaagaggcagggggcgctggaggtcttgaggatgatagacaccctg
accagaggagccgcagagtctcctgaagacaccgccgcgacggacatttctgactccgct
ctgttcgacagcatgtcaagactcggtctcccgaccgaccgcgacattgacctcagggag
agattcgtggaggaggaacccgagaggagcgactgtctagagaaaaagcgtgcaacaggc
ttcgtagagaagacgcaggtgaagagaggaagggaggagaccgcaggtagtttgagtagt
ttagaagcatttagcccttgttcagattctggaggacagcagcgtggcgttaacctgctc
ggggaaaagaccataccatgggtgctgattcccatcacaggtctgaaaatggagagatat
tcccagagacagatggactatcctgaagatccacgcttcgttcagagcccaaccgtgtct
acacacgccatgcctgacacaaaggacctgtcccctccctaccagccagatagcagcagc
acagcggtggatctgaatgtgcagacggctgcagaggttgaggatgaagagcccgtcgct
ccggctgtggccatagagtgtcctgcagacggcagcggttttgaccacatagtcgatgag
ctcgtctctggcttctccagtgaggtggagcagctcttgagggccaaacgtatttattat
gttgcttgctccagcactcagggctcacgagaaccgcttcagactccagctgtgccactt
tccaattacgtgtcaaactacaacactccgtttcccgtcagtagctacatgagctctttc
cacaacagcctgatgatgttcattgaccctcagcacgtcagtcgataccccggagctcag
gaagatgtgacttcctcctcgtctgctgcagaagttccttcagatgtccctgatacgtcc
tccagctttaatccgtgtgcttcctcgtcttccaacaacacctttgagtcatctctgaca
ccatgttctccttctagtgccctacctgagccaatgacgcagcctcaacatcactcaagt
ttgcccgaccctgatctccagcagacaccccagcagatgtgggctttagagcaggactcg
gtgaaccagaagatgcaggaagcaaacgtccctcatgatcttcatgaggtgaatggtagt
ctggttgctgagactacgggagctgtggagggtcaaacggacgcctcgattggacacgct
cattctgccatcagcagtatcatcgatcagctgcagcccgaggtgatcagtaacctggtg
gagatcatcaaaggagttcagaagaacattgtctacttctacatccattccacggatgag
gaggagagtgacgtctgctgggaaattaaggaatatttgataaagttggggaatttggag
tgtagcccacatggtttccttgagaaaagcagcagtcaagacaaactgctggtcatcatt
cagaatatggacatcgcagcacaggttcacaagataccttctctggtttccttgaagaag
catccgtctgtgagctttgctggtgtagacaacctgagtgacatccagaaccacacctac
aacgagctctttcagtccggaggcttcatcgtgtcagacgagcacgtcctgagcccagct
gtcatcacagcagataaacttcaagatatccttgagtacatcgagcagctcaactctcct
cagagcccctggaggtggagggtgcacttcaaatcacacaagaaactcagagagcacagc
aggctcaaacctgatgctttgaagctgttcgagatcctcaatgaatatgagaagagacac
atcgttgagatcctgtcgtaccacgactgtgacactccgtcacgtcaagcgcctgacctt
gactgtctagtggatctgcaagccagattcatcaaacagcgacacatgatatttctgaca
ggctgccagtttgagatgtttccccactactccagcagtggcattgtcatagccaatgtt
gatgacataaagtgtataataagcagtttagcggctggaggaagtgtggacagcgctccg
tcagcagaggcttgcggctctcccgctccagcgtcattgagagacgatagcatgtccttg
gactcggacctggattctccagataaccctgtcctggtctcagtctgtgttgtcccagac
cagtgcccactcgccgaaccctctctccaagaccaagccaagccaattcccgtgatcaca
accaccagcgagacgccaaaaccaatagactttgtggctctcagcgaagcaatttctcag
ttcaagacatccaggatgctttccaagtcggacgctggtgaaactctccagacgtctttt
ggagtcgatcctcaccagagcttcctcagccacagtggtctgtccgattcctatcctcag
tgctcctgggaaaaccacagcatgtccaatactcgtcctgagacgccagtccaagctgaa
gcagctggggctccgctgagctcttcttctccagtcgaagccagtcgtgaactggtccag
cttggagaaacggcagctgagagcagtatactgaatatgtccaaagcttgggagcaatcc
agcacaagctccaccgtcacggctaatgctggacaaatgtccactgaaagcggcgtttca
gagacgcctgcagtgagcagtgctagttcctctgaagcagcggtcacacatgggagcaga
cctggcagctctggacagggcttttatccaccgctgcagggcttcacggcgggccctagc
ttcatctctcacaatgctgctgttgggctcaggcatcctcttctgaactgcaccgttccc
aacagcctcggggtcgtgggagctccagtcttcacagggttcctgcccaatccgagcatg
cagatgtcctggagcggtggtttagcgcagggctcggcgccgggcctctgggggccgcac
tacggcgtagatatgcagcagatccatgggtctccgttcctccagacctggcagggaaac
tctgccttccagggcgacgcatatcatcccaacagaggaggattcggtggctggtga

DBGET integrated database retrieval system