KEGG   Sinocyclocheilus grahami: 107588533Help
Entry
107588533         CDS       T04918                                 

Definition
(RefSeq) mitogen-activated protein kinase 6-like
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107588533
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107588533
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107588533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH PAN_2
Motif
Other DBs
NCBI-GeneID: 107588533
NCBI-ProteinID: XP_016132151
LinkDB All DBs
Position
Unknown
AA seq 720 aa AA seqDB search
MAEKFESLMNIHGFDLGPRYMDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIVLTDPQSIK
HALREIKIIRRLDHDNIVKVFETLGPSGRRLTEDVSSLTEVNSVYIVQEYMETDLCKVLE
QGLLSEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRLELQSVIPVFIKNDMSEPHTPLAKLLPGVSPEALDFLEKILTFN
PMDRLTAEEALAHPYMSDYSFPLDEPVSLHPFHIEDEVDDILLMDESHSHIYNWDRYHES
QFSDQDWHLHSTHELEDVQRDPRAMSDGTDEEEVQIDPRKYMDGECEKFLEDPSFDLPPE
RSWQQEDHHENKYCDQECSYTCNYKAVSPSYLDNLIWRDSEVNHYYEPKLIIDLSNWKEQ
QSKEKNDKKGKTKCEKNGLVKAQIALQNHCVAEKDREQEKHQGFDFDSFIASTIKMSLQP
ESGDVDLLNELNTSVSQLDTRAPCGSMSKSISQEKEEKCLVNLAQLGVRAPCPWESFTDS
DVTESSIIDEACWDVRKDEQLQKENSSCQSSYLDRLFNKREEVESEIPEPVEESTPEDDF
ISCGGEIVFNMQLESLAIPGFEGAGDIPLKSIQATLTPSAVKRSPQIAHKTYSSIFKHLN
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagccttatgaacattcacggcttcgacctgggccctcgctac
atggacctaaagcctctgggctatgggggcaacggactggtcttttccgccgtcgacacc
gattgtgacaagagggtcgctgtgaaaaagattgtcctaaccgatcctcagagcatcaaa
cacgcactgcgcgaaatcaagatcattcgcaggctcgatcacgacaacatcgtgaaggtg
tttgaaacgctggggcccagtggccggaggctcacggaggacgtgagctctctgacggag
gtcaactctgtgtacatcgtacaggagtacatggaaacagacctctgtaaagtgctggaa
cagggcttgttgtccgaggatcatgcacggctgttcatgtaccaactgctgcgaggactc
aaatacatccactctgcaaacgtgcttcaccgagacctgaagcctgccaacctcttcgtc
aatactgaggacctggtactgaaaattggggattttggacttgcccgtatcatggacccc
cactattcccataaggggtatctgtctgagggactggtcactaaatggtatcgttctcct
cgtctgctcctttccccaaataactacaccaaagccattgacatgtgggccgcagggtgc
atctttgctgaaatgctgactggaaaaactctctttgcaggagctcacgagctggaacag
atgcagctgattctggaatccattccggtagtccatgaggaagacagactggagctccaa
agtgtaatacctgtctttatcaagaacgacatgtcagaaccacacacgccgctcgccaag
ttattgcctggtgtcagccctgaggccttggatttcctggagaagatcttgacgtttaac
cccatggaccggctcactgcggaagaggctcttgctcacccatacatgagcgattactcc
ttccctctagacgaaccagtgtctttgcatcccttccacattgaggatgaggtggatgac
atcttgctcatggatgagagccacagtcacatctacaactgggacaggtaccatgaaagt
cagttctctgatcaagactggcacctgcacagcacccatgaactagaagacgtgcagcgg
gatcctcgagctatgtcagatggcacggatgaggaggaggtccagatcgatccacgcaaa
tacatggatggggagtgtgagaagttcctagaggatccatcgttcgatcttccaccagag
cgctcgtggcaacaggaagatcaccatgagaacaaatactgcgaccaggagtgcagctac
acttgcaactacaaagctgtgtccccatcctacctggacaatctgatctggagggacagt
gaggtgaaccactactatgagcccaaactcatcattgacctctccaactggaaagaacag
caaagcaaagagaagaatgacaaaaaaggcaagaccaagtgtgagaagaacggactggtc
aaggcccagatcgccctgcaaaaccactgcgtggccgagaaggatcgcgaacaagaaaaa
caccagggcttcgactttgattcgtttatcgccagcactatcaaaatgagccttcagcca
gaatccggcgacgttgacctcctgaatgagttgaacacctccgtttcccagctggacacc
cgtgctccttgcggctccatgtccaagtccatcagtcaggagaaagaagagaagtgtctt
gtaaacctggcacagctcggcgtccgagcaccctgtccttgggagagtttcacggacagc
gacgttaccgagagcagcataatcgacgaggcttgctgggacgtccgcaaagatgagcag
ctccagaaggagaacagcagctgccagagcagttacttagaccgcctcttcaacaagcgt
gaggaggtagagtccgagatccccgaacctgtcgaggagtccacaccggaggatgacttc
atatcctgtggcggcgagattgtctttaacatgcagctggagtctctggccattccgggg
ttcgagggagcgggtgacattcctctgaagtccatccaggccacgttaacgccctctgct
gttaagcgctccccacaaatcgcccacaaaacctacagcagcattttcaagcatttaaat
taa

DBGET integrated database retrieval system