KEGG   Sinocyclocheilus grahami: 107589041
Entry
107589041         CDS       T04918                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04260  Cardiac muscle contraction
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107589041
   04020 Calcium signaling pathway
    107589041
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107589041
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107589041
   04261 Adrenergic signaling in cardiomyocytes
    107589041
   04270 Vascular smooth muscle contraction
    107589041
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sgh04040]
    107589041
Ion channels [BR:sgh04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107589041
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel CAC1F_C DUF2670 DUF4834
Other DBs
NCBI-GeneID: 107589041
NCBI-ProteinID: XP_016132831
LinkDB
Position
Unknown
AA seq 1835 aa
MVNESKNMYIPEDTLENHQGSNYSSPSLAPVPSLNEDEHVGDGGGVLGLAPEHIPTPGAP
LNWQAAINAARQAKLMGTTAAPICTASSTQRKRQHYTKPKKQASTASTRPPRALLCLTLK
NPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIF
TVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTSMGGKAAG
FDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELF
MGKMHRTCFFFKDGHKGTISEEKPAPCAPSSTHGRHCSPTNITQCMMGWAGPNDGITNFD
NFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLRTE
FSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENDDEGLDDDKPRNLSIP
ASENESVNTDNAPAGDMEGETCCTRMANRISKSKFSRYSRRWNRLCRRTCRAAVKSNVFY
WLVIFLVFLNTLTIASEHHQQPDWLTNVQDIANKVMLALFTGEMLLKMYSLGLQAYFVSL
FNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNS
VRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWN
SVMFDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEE
EEEKERKKLARTASPEKRQNSEKPPLEDEKKEEKIELKSITSDGETPTATKINIDEYTGE
ENEEKNPYPVNDFPAAAEDDEEPEMPVGPRPRPLSDIQLKEKAVPMPEARAFFIFSPDNK
FRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVNNDSFRNQILGYADYVFTGIFTIEI
ILKMTTYGAFLHKGSFCRNYFNILDLVVVSVSLISSGVQSSAINVVKILRVLRVLRPLRA
INRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTDTSKQTQSE
CRGSYILFKDGNVGKPVKSQRSWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSH
AEDVGPVYNYRVIISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQ
CVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQSQSFS
KAMNILNMLFTGLFTVEMILKLIAFKPRHYFVDAWNTFDALIVVGSVVDIAITEVNPADP
SSSPPSSVVRPMGLQNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQAL
PYVALLIVMLFFIYAVIGMQMFGKIALRDNSQINRNNNFQTFPQAVLLLFRCATGEAWQE
IMLACSPNRPCEKGSEVNHNSEDCGSHFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLT
RDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRL
VSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQ
VVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVSKIPPKTALSLQAGLRTLHDMGP
EIRRAISGDLTVEEELERAMKETVCSASEDDIFRRSGGLFGNHVDYYHQSDGHASFPQSF
TTQRPLHISKSGSPGEAESPSHQKLVDSTFTPSSYSSSGSNANINNANNTAIGHRYPKPT
VSTVDGHTGPPLTTVPLPRPTWCFPNKRYDDICFL
NT seq 5508 nt   +upstreamnt  +downstreamnt
atggtaaatgaaagcaaaaacatgtacataccggaggacacccttgaaaaccatcaaggc
tccaactattccagtccgtcgttggctccagtccccagtctgaatgaggacgagcatgtg
ggggacgggggtggggtgctgggtcttgcacctgaacacattcccacccctggtgccccc
ctcaactggcaggcagccatcaacgcggcacggcaggccaagctgatgggcaccaccgca
gccccgatctgcactgcgagctccacacagcgcaaacgccagcactacaccaaacccaag
aaacaggccagcactgcctccacgcgcccaccccgagcccttctctgcctcactcttaaa
aaccctatccgcagggcgtgcatcagtattgtggaatggaaaccgtttgaaatcataatt
ttgatgactatttttgcaaactgtgtggccttagctgtctacatccctttcccagaggac
gattccaacgcaaccaactcaaacctggaacgggtggagtatctctttctgatcattttt
acggtggaagcatttctcaaagttattgcatacgggttgctgtgtcaccctaatgcgtac
ctgcggaacggctggaacttgttggatttcatcatcgtggtggtagggctgttcagtgca
atattagagcaggccactaaaggggatggtgggacttcaatgggaggcaaggctgcaggg
tttgatgtaaaagccctgcgagcctttagagtgttgagacctctgagactcgtatctgga
gtacctagtttacaggtggtgctgaactccatcattaaagccatggttcccctcctgcac
atcgctctgctcgttctgttcgtcatcatcatttatgccatcatcggcctcgagctcttc
atgggcaagatgcacagaacctgttttttcttcaaagatggacacaaaggtactatatct
gaagagaagccggccccctgcgccccaagctccacccatggacgacactgctccccgacc
aacataacgcagtgcatgatgggatgggcaggcccaaatgatggaatcacgaactttgat
aactttgcatttgccatgctgactgtgtttcaatgcatcacgatggagggctggactgac
gtcctgtactggatgcaggatgccatgggttatgagcttccatgggtctattttgtcagt
ctggtcatctttggatcctttttcgttctaaatttggttctgggtgtgttgagaacagag
ttctctaaagagcgagaaaaggccaaagctcgcggtgatttccagaagctccgtgagaag
cagcagctggaggaggatctaaagggctacctggactggatcactcaggcggaggacatc
gaccctgagaacgacgacgagggactggatgacgacaagcctagaaatctgagtataccg
gccagtgaaaatgagtcagtgaacactgataatgctcccgctggagacatggagggagag
acctgctgtactcgcatggcaaataggatctccaaatccaaattcagtcgatattcacgc
cgatggaatcggttatgtcggcgcacgtgccgtgcagcagtgaagtcaaatgtgttctac
tggctggtgattttcctggtatttttgaacacgcttaccattgcctctgagcaccaccag
cagccagactggctcaccaatgtacaagatatcgccaataaggtgatgctggctcttttt
accggtgagatgctgctgaagatgtacagcctgggcctacaggcctatttcgtctccctt
tttaaccgcttcgacagttttgtggtgtgcggtggaattctggagactatcctggtagag
actaagatcatgtcgcccctcggcatctctgtgctgcgctgtgtgcgtctgctccgcatc
ttcaagatcaccaggtactggaactctctcagtaatctagtggcgtctctgctgaactcg
gtgcgctctatcgcgtccctgcttctgctactcttcctgttcatcatcatcttcagtctg
ctcggaatgcagctctttggtggcaagttcaactttgacgagacgcgccgcagcaccttc
gataacttcccccagtctctcctcaccgtctttcagattttgaccggagaggactggaac
tctgtgatgtttgatgggatcatggcgtacggtgggccctcctttcctggcatgcttgtc
tgcatttatttcatcatcctcttcatctgcggaaactacatcctcctgaatgtcttcttg
gccattgccgtggacaacctggcagacgcagagagtctgacatcagcgcagaaagaggaa
gaggaggagaaagagaggaagaagctggccagaacggccagtccagagaagcgccagaac
tctgagaaaccacctctggaggatgaaaagaaagaggaaaagattgaactaaaatccatc
acttctgatggagagacaccaactgctaccaagatcaacatagatgagtacacaggggag
gagaatgaggagaagaacccatatcctgtgaacgatttcccagcagcagcggaggacgat
gaggagccagagatgccagtaggtcctcgtccacgtccactctccgacattcagctgaag
gagaaagctgtccccatgccagaagccagagctttctttattttcagccccgataacaag
ttcagggttttgtgtcataagattgtaaaccacaacatcttcaccaatttaatcctgttc
tttatactgctgagcagtatttcactggcagcggaggacccagtgaataatgactcattc
aggaatcagattctaggctatgcagattatgtgtttacaggaatcttcaccatagagatc
atactgaagatgacaacgtatggagcattcctacataagggttcattttgtcggaattat
tttaatattttggatctggtggtggtcagtgtgtctctgatctcctctggagttcagtca
agtgccattaatgtagtgaagattctcagagtgctgagggtgttgaggcccctgagagca
atcaacagagccaagggcctcaaacatgtggtccagtgtgtgtttgtagccatccgtacc
atcgggaacatcgttatcgtcaccactttgctgcagttcatgtttgcctgtattggtgtt
caacttttcaagggcaaattcttctactgcacagacacctctaaacagacacagtccgaa
tgcagggggtcctatatattattcaaagatgggaatgttgggaagccagtgaaatcacag
cgttcatgggagaacagtgacttcaactttgatgatgtcctgcagggcatgatggctctg
tttgccgtgtccacttttgagggttggccagggctcctctacagagccattgactcccat
gcagaggatgttggtccagtctacaactaccgtgtgatcatctctatatttttcatcatc
tacatcatcatcattgccttcttcatgatgaacatattcgtaggtttcgtcattgtgaca
tttcaggagcagggagagcaagagtacaaaaactgtgagctggacaagaaccagcgtcag
tgtgtggaatatgccctgaaggctcgtcccctgcgcaggtacatccccaagaacccgtat
cagtacaaggtatggtacgtggtgaactctacctactttgagtacctgatgttcaccctc
attcttctcaacaccatctgcctggccatgcagcatcatggccaatctcaatcgttcagc
aaagccatgaatatcctcaatatgttgttcaccggcctattcactgtggaaatgatcctc
aaactcatcgccttcaaacccaggcattattttgttgatgcatggaacacatttgatgcc
cttattgtagtgggtagtgttgttgatatagccatcacggaggttaacccagctgacccc
tcctcctctcccccctcttctgtggtaagaccaatgggcctccaaaacactgaagataat
gccaggatctcaatcacgttctttcggctgttccgtgtgatgaggctggtgaagctcctg
tctcggggagagggcattcggacgctgctctggaccttcattaaatcctttcaggctctt
ccctatgttgctttgctgatcgtaatgctgttcttcatctacgccgtcattgggatgcag
atgttcggtaagattgccctgagggacaacagccagatcaaccgaaacaacaactttcag
acgtttcctcaggctgttctgctgctcttcaggtgtgcaacaggggaggcgtggcaggaa
atcatgctggcctgttctccgaaccgcccgtgtgagaaggggtcagaggtcaaccacaac
agtgaagactgtggcagccactttgccatcatctactttgttagcttttatatgctttgc
gccttcctgatcattaacctctttgtggccgtcatcatggacaactttgactatttaaca
cgtgattggtcgatattggggccgcatcacctggatgagtttaagaggatatgggcagaa
tacgatcctgaggccaagggtcggataaagcacctggatgtggtgacgttgctgcgcagg
attcagcctccccttggatttggaaagctttgtccacatagagtggcgtgcaagcggctt
gtgtccatgaacatgcctctcaatagtgacgggacggtgatgttcaacgcaactctcttt
gctctggtacgaacggctctacgcatcaaaactgaaggtaacctggagcaagcaaatgag
gaactccgggccatcgtgaagaagatctggaagaggacgagcatgaagctgctggatcaa
gtcgttccccctgctggagatgatgaagtaacagtggggaagttctatgccacatttctg
attcaggaatacttcaggaaatttaagaagcgcaaggaacagggcctggtgtccaaaatt
cctccaaagacggctctttcactgcaggctggcctgcgtacactgcatgatatgggtcct
gagattagaagagcgatatcaggagacctgactgtggaggaggagctggagagagccatg
aaggaaaccgtgtgttctgcatctgaggatgatatcttcaggcggtctggcggtctcttc
ggtaaccacgtcgactactaccaccagagtgacggccacgcctccttcccacagtccttc
acaacacagcggccgttgcacatcagtaaatccgggagtcccggcgaagcagaatctccg
tctcatcagaagctcgtcgactccaccttcactccgagcagttattcttcctcgggatcc
aacgcaaacattaacaacgccaacaacacagccatcggacaccggtaccccaaacctacc
gtcagcacagtggacggacacacggggccgcccctcaccaccgtcccactaccacggccc
acatggtgctttcctaacaagaggtatgatgacatatgctttctgtag

DBGET integrated database retrieval system