KEGG   Sinocyclocheilus grahami: 107590325
Entry
107590325         CDS       T04918                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04012  ErbB signaling pathway
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107590325
   04068 FoxO signaling pathway
    107590325
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107590325
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107590325
NCBI-ProteinID: XP_016134516
UniProt: A0A672QJB3
LinkDB
Position
Unknown
AA seq 183 aa
MSKVRVSNGSPTLERVDARQADHAKPPVCRNLFGSVDRAEFARDVKEQMLAMEKASKDKW
NYDFAKNEPLAPGDYDWQEVDAKEVPEFYTRPPHAKRDTSTGTVDHNGNHDYLLTTSVQG
DSDNAEHGSRSDCRTALTTPRKRPSTEDQDLPCQSKRANVQATEANCCPETRSHAPSKSD
PKT
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtcaaaagtgcgcgtctccaatggaagcccgacgctggagagagtggacgcgaggcag
gcggatcacgccaaaccgccggtctgcagaaacctcttcggctccgtggatcgcgcagag
ttcgcgagggacgtcaaggagcaaatgctggccatggagaaagcgtccaaggacaaatgg
aattacgacttcgccaaaaacgagcccctcgcgcctggcgactacgactggcaggaggtg
gacgcgaaagaggtgccggagttttacaccagaccgcctcacgcaaaacgggatacctcg
accgggactgtggatcacaacgggaaccacgactacttgttgacgacgagcgtacagggg
gactcggacaacgcggagcacgggagtcgctcggattgccgaacggcgctgaccacgccg
agaaaaagaccgtcgacagaggatcaggatcttccttgccaaagcaaaagagccaacgtc
caagcgaccgaggcgaactgctgcccagagacgaggtcgcacgcgcccagcaagtcggat
cccaaaacgtaa

DBGET integrated database retrieval system