KEGG   Sinocyclocheilus grahami: 107590367Help
Entry
107590367         CDS       T04918                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like isoform X1
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04210  Apoptosis
sgh04625  C-type lectin receptor signaling pathway
sgh04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107590367
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107590367
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107590367
   04672 Intestinal immune network for IgA production
    107590367
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107590367
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     107590367
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: STE group
  Other
   107590367
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 107590367
NCBI-ProteinID: XP_016134559
LinkDB All DBs
Position
Unknown
AA seq 890 aa AA seqDB search
MPKHAVYVCSSLGFDMHPSSFRLERSEELDSVRRKTVLLSYLIQIKNFKMQRFLNSTVPF
SHMAQRDIKALNCPGSSPASRTESKAGELDKIHHLSNYLKNVMYQGTADYEWTHRTEKQT
IIAQAECESQDSQEFCPNGSISSQSLIGTISRSRPRKKRHKKHRRKRGEKDSRASESVEV
TGVPEQDSGEFHSSSLIQVIDPVCISSSISSTTYSSSGLSTERVSVQETEGPSNPYQWES
QQTSLLSLSSCQTYGQESEELNSPLRSETECPLAATALRNFVTTEDPCFAYCFVKDVLRE
ERERDEDEREESDKNEGILFKEGLQPVNYEYREGREYERCRFLKQGSFGEVYSIKDKGTG
FVCAAKKVPLVSFSSEEVGSWSALQSPQVVELFGVVREGPSIILFMDLKSSSLGQLVEER
GRLPEDLSLHYLQQVLGALNHLHRKRVLHLDIKADNILLSEDGKDAFLCDFGYSERLDKQ
GLSYCKSLKGTETHMAPEVLLNEPRTSKADIWSSCCMLLHMLNGCHPWTRYYSRPLFLKI
AEEPPPLREIPCDCSSYTADVIKAGLQKDPIKRASAKELFVKTAKALKGVGGLRSRARGG
PYQKPLGKPENPDPAYSATPTTSHQTTSSDNSELQWMSSEHKRKVGNEKPEKVKQWKQTE
ETRNDDHCPPKSLLHIQNTSPEPRIIKTEPEPEQELRRLEKDFYLSSLSLPHSAELQEQL
LSCLCSDCPSTRENFDKKDSGRWSFGPGDDLSSGVFSYNSQQDGQSFSRDWLAPTHQPLP
RCFDGVDVYIRDFDGKCFHIREVPGVKVCHVARGISDQISENVFSLQTEDGCLVPHDKEV
LENSLFLRCVPAPDSSHYHQYGHSPCCTPGPNCKLPWSWRIREGVLETKD
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaacatgctgtctatgtatgcagctcactaggttttgacatgcatccttcgtct
ttccgtctcgagcgatcagaagagctcgactccgtccgacgcaagaccgttctcctgtct
tatttaatacaaattaagaatttcaagatgcagcgatttttgaactccactgtcccgttc
tcccacatggcccaaagagatattaaagctctcaactgccccggctcgagcccagcctct
cgcacagagagcaaagcaggagagctggacaaaatacatcacttgagtaactacctcaag
aatgtcatgtatcaaggaactgccgactatgagtggacacacaggacagagaaacaaacg
attattgcacaggcagagtgtgagtcccaggattcacaggagttctgccccaatggcagc
atctcctcccagtcgcttattggcactatttctcgcagtcggcccaggaagaagcggcat
aagaaacatcggcgaaaacggggtgagaaggacagccgagcaagcgagtctgtggaagtc
accggcgtgccagaacaggacagcggcgagttccattcatcatctcttattcaggttata
gatcctgtgtgcatcagcagcagtatcagtagtactacatacagcagcagtggcctcagt
acggagagggtgtctgtgcaggaaacagagggcccgtcaaacccttatcagtgggagtcc
cagcagacctccttactgagcctctcctcctgccagacctacggccaagagagtgaggag
ctgaattctcccctgagaagtgagactgaatgccctctggctgctacagccctgaggaac
tttgttacaactgaagatccctgctttgcatactgctttgtcaaagatgtgctgagagag
gagagggagagggatgaggacgaaagagaggagagcgacaagaatgaagggatcctgttc
aaagaggggctacaaccagtgaattatgagtacagagagggacgggagtatgaacgctgt
agatttctcaagcagggctccttcggagaagtctacagcatcaaagacaaaggcaccggc
ttcgtgtgtgctgccaaaaaggtgccgttggtgagtttcagcagcgaggaggtgggctcg
tggagtgccctgcagtctcctcaggtggtggaactctttggtgtggtgcgtgaaggtcct
tccatcatccttttcatggaccttaaatccagttctctaggacagctggtggaggaacga
ggccgcctgccagaggatctgtccctgcactaccttcagcaagtactgggggcactaaac
cacctgcataggaagcgggtccttcacctggacatcaaagcggataacattttgctgtca
gaagatgggaaagatgcattcctgtgcgactttggatactccgagagattggacaaacaa
gggcttagttattgtaagagtctgaaaggcacagaaactcatatggcacctgaggtgttg
ctcaatgagccgcgcacttcaaaagcagacatctggagcagctgctgtatgcttctgcac
atgctcaacggctgtcatccgtggacccgctactattcccgcccactcttcctcaagata
gcagaagagcctccgccactgagggaaattccatgtgactgcagctcctatacagcagat
gtcataaaagcaggactgcagaaagatccaatcaaacgagcttctgccaaagaacttttt
gttaaaactgctaaagcacttaaaggagtcgggggacttcgcagccgcgcgagaggagga
ccctatcagaagccactagggaagccagagaatccagaccctgcctattcagccacaccc
accacatcccaccaaaccacgtcctctgataactctgagctgcagtggatgagctcggag
cacaagaggaaagtgggtaatgagaagccagaaaaggtaaaacagtggaaacagacagag
gagacaagaaacgatgaccactgtcctccgaagtcactgctccacattcaaaacacttca
cctgagccacggatcatcaagaccgagccggagccggaacaagagctgaggagactggag
aaagatttctacctgagcagtctttccctgcctcattctgctgagctacaggagcagctg
ctctcttgtctctgtagcgactgcccttccactagagaaaactttgacaagaaggattca
ggacgttggtcattcggccctggcgatgatcttagctcaggcgtgttttcttacaatagc
caacaagatggccagagcttcagcagggactggctcgcccccacgcatcaacctctgccc
cgctgctttgatggggtggatgtttatatcagggactttgacgggaaatgctttcatatt
cgggaggtgcccggggtgaaagtatgccacgttgctagaggaatcagcgatcagatctcg
gagaacgtgttcagcctgcaaacagaggatggttgcttggtgccccatgacaaagaggtc
ctagagaacagcctgtttttgcgttgtgtcccggcccccgactccagccactatcatcag
tacggacacagcccctgctgcacgcctggccccaactgcaaactaccatggagctggagg
atcagagagggggtgctggagactaaagactga

DBGET integrated database retrieval system