KEGG   Sinocyclocheilus grahami: 107590584
Entry
107590584         CDS       T04918                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04260  Cardiac muscle contraction
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107590584
   04020 Calcium signaling pathway
    107590584
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107590584
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107590584
   04261 Adrenergic signaling in cardiomyocytes
    107590584
   04270 Vascular smooth muscle contraction
    107590584
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sgh04040]
    107590584
Ion channels [BR:sgh04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107590584
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Rer1
Other DBs
NCBI-GeneID: 107590584
NCBI-ProteinID: XP_016134919
LinkDB
Position
Unknown
AA seq 2182 aa
MVNESKNMYIPEDTLENHQGSNYSSPSLAPVPSLNEDERVGGGGGVLGLAPEHIPTPGAP
ISWQAAIDAARQAKLMGTTGAPISTASSTQRKRQHYTKPKKQASTASTRPPRALLCLTLK
NPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIF
TVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTSMGGKAAG
FDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELF
MGKMHRTCFFFKDGHKGPISEEKPAPCAPNSAHGRHCTPANVTQCMMGWEGPNDGITNFD
NFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGE
FSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENDDEGLDDDKPRNLSMP
ASENESVNTDNAPAGDMEGETCCTRMANRISKSKFSRYSRRWNRLCRRTCRAAVKSNVFY
WLVIFLVFLNTLTIASEHHQQPEWLTNVQEIANKVLLALFTGEMLLKMYSLGLQAYFVSL
FNRFDSFVVCGGILETILVEIKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNS
VRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWN
SVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEE
EEEKERKKLARMASPEKRQDSEKPPLEDEKKEEKIELKSITSDGDAPTATKINIDEYTGE
ENEEKNPYPVNDFPAGEEDDEEPEMPVGPRPRPLSDIQLKEKAVPMPEAKAFFIFSATNK
FRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVNNDSFRNQILGYADYVFTGIFTIEI
ILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRA
INRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFSYCTDTSKQTQTE
CRGFYILYKHGNVGKPEKAQRSWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSH
AEDVGPIYNYRVIISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQ
CVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQSQSFS
KAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINPADP
SSSPPSSVVRPMGLQNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQAL
PYVALLIVMLFFIYAVIGMQMFGKIALRDHSQINRNNNFQTFPQAVLLLFRCATGEAWQE
IMLACSPNRPCEKGSEVGHSSEDCGSHFAIFYFVSFYMLCAFLIINLFVAVIMDNFDYLT
RDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRL
VSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQ
VVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKIPPKTALSLQAGLRTLHDIGP
EIRRAISGDLTVEEELERAMKETVCAASEDDIFRVKRSGGLFGNHVNYYHQSDGHASFPQ
SFTTQRPLHISKSGSPGEAESLSHQKLVDSTFSPSSYSSSGSNANINNANNTAIGHRYPK
PTVSTVDGHTGSPLTTVPLPRPTWCFPNKRSCFYDTFMRSDSSDSHLPIIRREEASTDET
YDETFLDERDQTMLSMDMLEFQDEESKQLAPMVEAEVGEERRPWQSPRRRAFLCPTALGR
RSSFHLECLRKHNRPDVSQKTALPLHLVHHQALAVAGLSPLLRRSHSPTLFTRLCSTPPA
SPSGRGGGGPCYQPVPSLRLEGSGSYEKLNSSMPSVNCSSWYSDSNGNHSRSVQRTQRPV
SLTVPPVTRRDSTSLSHGSAGSLVEAVLISEGLGCYAQDPSFIQVAKQELADACDMTMEE
MENAADNILNANAPPNANGNLLPFMQCRDTGSQESRCSHALGLSTTTGSDELLGAELECS
EGEGQQNSTLMEDGDMECVTSL
NT seq 6549 nt   +upstreamnt  +downstreamnt
atggtaaatgaaagcaaaaacatgtacataccggaggacacccttgaaaaccatcaaggc
tccaactattcaagtccgtcgttggctccagtccccagtctgaatgaggacgagcgtgtg
gggggcgggggtggggtgctgggtcttgcacctgaacacattcccacccctggcgctccc
atcagctggcaggcagccatcgacgcggcacggcaggccaagctgatgggcaccaccgga
gccccgatctccactgcgagctccacgcagcgcaaacgccagcactacaccaaacccaag
aaacaggccagcactgcctccacgcgcccaccccgagcccttctctgcctaactcttaaa
aaccccatccgcagggcgtgcatcagtatcgtggaatggaaaccgtttgaaatcataatt
ttgatgactatttttgcaaactgtgtggccttagctgtctacatccctttccccgaggac
gattccaacgcaaccaactcaaacctggaacgggtggagtatctctttctgatcattttt
acagtggaagcatttctgaaagttattgcatacgggctgctgtgtcaccctaatgcgtac
ctgcggaacggctggaacttgttggatttcatcattgtggtggttgggctcttcagtgca
atattagagcaggccactaaaggggatggtgggacttcaatgggaggcaaggctgcaggg
tttgatgtaaaagccctgcgagcctttagagtgttaagacctctgagactcgtatctgga
gtacctagtttacaggtggtgctgaactccatcattaaagccatggttcccctcctgcac
atcgctctgctcgttctgttcgtcatcatcatttatgccatcattggcctcgagctcttc
atgggcaagatgcacagaacctgttttttcttcaaagatggacacaaaggtcctatatct
gaagagaagccagccccctgtgccccaaactcggcccatggacgacattgcaccccggcc
aacgtaacgcagtgcatgatgggatgggagggcccaaatgatggaatcacgaactttgat
aactttgcatttgccatgctgactgtgtttcagtgcatcacgatggagggctggactgac
gtcctgtactggatgcaggatgccatgggttatgagcttccgtgggtctattttgtcagt
ctggtcatctttggatcctttttcgttctaaatctggttctgggtgtgttgagcggagag
ttctctaaagagcgagaaaaggccaaagctcgcggcgatttccagaagctccgtgagaag
cagcagctggaggaagatctgaagggctacctggactggatcacgcaggcggaggatatc
gaccctgagaacgatgacgagggactggacgacgacaagcctagaaatctgagtatgccg
gccagtgaaaatgagtcagtgaacactgataatgctccagctggagacatggagggagag
acctgctgtactcgcatggcaaataggatctccaaatccaaattcagtcgatattcacgc
cgatggaatcggttatgtcggcgcacgtgccgtgcagcagtgaagtcaaatgtgttctac
tggctggtgattttcctggtatttttgaacacacttaccattgcctctgagcaccaccag
cagccagaatggctcaccaatgtgcaagaaatcgccaataaggtgttgctggctcttttt
actggtgagatgctgctgaagatgtacagcctgggcctacaggcctatttcgtctccctt
tttaaccgctttgacagttttgtggtgtgcggtggaattctggagactatcctggtggaa
atcaagatcatgtcacccctcggcatctctgtgctgcgctgtgtgcgtctgctccgcatc
ttcaagatcaccaggtactggaactctctcagtaatctggtggcatctctgctgaactcg
gtgcgttctatcgcatccctgcttctgctgctcttcctgttcatcatcatcttcagtctg
ctcggaatgcagctctttggtggcaagttcaactttgatgagacgcgccgcagcaccttc
gataacttcccccagtctctcctcaccgtctttcagattttgaccggagaggactggaac
tctgtgatgtatgatgggatcatggcgtacggtggaccctcctttcctggcatgcttgtc
tgcatttatttcatcatcctcttcatctgcggaaactacatcctcctgaatgtcttcttg
gccattgccgtggacaacctggcagacgccgagagtctgacatcagcgcagaaagaggaa
gaggaggagaaagagaggaagaagctagccagaatggccagtccagagaagcgtcaggac
tctgagaaaccacctctggaggatgaaaagaaagaggaaaagattgaactaaaatccatc
acttctgatggagatgcgccaactgccactaagatcaacatagatgagtacacgggggag
gagaatgaggagaagaatccatatcctgtgaacgatttcccagcaggagaggaggatgat
gaggagccagagatgccagtaggtcctcgtccacgtccactctccgacattcagctgaag
gagaaagctgtccccatgccagaagccaaagctttctttattttcagcgccactaacaag
ttcagggttttgtgtcataagattgtaaaccacaacatcttcaccaatttaatcctgttc
tttatactgctgagcagtatttcactggcagcggaggacccagtgaataatgactcattc
aggaatcagattctaggctatgcagattatgtgtttacaggaatcttcaccatagagatc
atattaaagatgacagcgtatggagcattcctacataagggttcattttgtcggaattat
tttaatattttggatctggtggtggtcagtgtgtctctgatctcctctggaattcagtca
agtgccattaatgtagtgaagattctcagagtgctgagggtgttgaggcccctgagagca
atcaacagagccaagggcctcaaacatgtggtccagtgtgtgtttgtagccatccgtacc
atcgggaacatcgttatcgtcaccactttgctgcagttcatgtttgcctgtattggcgtt
caacttttcaagggcaaattctcctactgcacagacacctctaaacagacacagaccgaa
tgccgggggttctatatattatacaaacacgggaatgttgggaagccagagaaagcacag
cgttcatgggagaacagtgacttcaactttgatgatgtcctgcagggcatgatggctctg
tttgccgtgtccacttttgagggttggccagggctcctctacagagccatcgactcccat
gcagaagatgttggcccaatctacaactaccgtgtgatcatctctatattcttcatcatc
tacatcatcatcatcgccttcttcatgatgaacatattcgtaggtttcgtcattgtgaca
tttcaggagcagggagagcaagagtacaaaaactgtgagctggacaagaaccagcgccag
tgtgtggaatatgccctgaaggctcgtcccctgcgcaggtacatccccaagaacccgtat
cagtacaaggtgtggtatgtggtgaactccacctactttgagtacctgatgttcaccctc
atccttctcaacaccatctgcctggccatgcagcatcatggccaatctcagtccttcagc
aaagccatgaatatcctcaatatgttgttcaccggcctcttcactgtggaaatgatcctc
aaactcatcgccttcaaacccaggggttactttagtgacccctggaatgtttttgacttc
ctcatcgtaattggcagcattatagacgtcattctgagtgagatcaacccagctgacccc
tcctcctctcccccctcctctgtggtaagaccaatgggcctccaaaacactgaagataac
gccaggatttcgatcacgttctttcggctgtttcgcgtgatgaggctggtgaagcttctg
tctcggggagagggcattcggacgctgctctggaccttcattaaatcctttcaggctctt
ccctatgttgctttgctgatcgtaatgctgttcttcatctacgccgtcattggaatgcag
atgtttggtaagattgccctgagggaccacagccagatcaaccgaaacaacaactttcag
acatttcctcaggctgttctgctgctcttcaggtgtgcaacaggggaggcatggcaggaa
atcatgctggcctgttccccgaaccgcccatgtgagaaggggtcagaggtcggccattcc
agtgaagactgtggcagccactttgccatcttctactttgttagcttttatatgctttgc
gccttcctgatcattaacctctttgtggccgtcatcatggacaactttgactatttaaca
cgtgattggtcgatattgggaccgcatcacctagatgagtttaagaggatatgggcagaa
tacgatcctgaggccaagggtcggataaagcacctggatgtggtgacgttactgcgcagg
attcagcctccccttggatttggaaagctttgtccacatagagtggcatgcaagcggctt
gtgtccatgaacatgcctctcaatagtgacgggacggtgatgttcaacgcaactctcttt
gctctagtacgaacggctctacgcatcaaaactgaaggtaacttggagcaagcaaatgag
gaactcagagccatcgtgaagaagatctggaagaggacgagcatgaagctgctcgatcaa
gttgttcccccagctggagatgatgaagtaaccgttgggaagttctatgccacattcctg
attcaggaatacttcaggaaatttaagaagcgcaaggaacagggcctggtggccaaaatt
cccccaaagactgctctttcactgcaggctggcctgcgcacactgcatgatattggtcct
gagatcagaagagcgatatcaggagacctgactgtggaggaggagctggagagagccatg
aaggaaaccgtgtgtgctgcttctgaggatgatatcttcagggtaaagcggtctggcggc
ctcttcgggaaccatgtcaactactaccaccagagtgatggccacgcctccttcccacag
tccttcacaacacagcggccattgcacatcagtaaatccgggagtcccggcgaggcagaa
tctctctctcatcagaagctcgtcgactccaccttctctccgagcagttactcttcctca
ggatccaacgcaaacatcaacaacgccaacaacacagccatcggacaccggtaccccaaa
cctaccgtcagcacagtggacgggcacacggggtcgcccctcaccactgtcccactacca
cggcctacatggtgctttcctaacaagaggagctgtttctatgacactttcatgcgctct
gattccagtgacagtcatctccctataatacggcgagaggaagcatctacagatgagacg
tacgatgaaacatttctagatgagagagatcagaccatgctctcaatggacatgctggaa
tttcaggatgaagagagcaagcaattggctccaatggtggaggcagaagtaggggaagag
aggaggccgtggcagtctccacgaagacgggcatttctctgccccactgcactgggtcga
cggtcttcctttcacttagagtgtttgagaaaacataacagacctgatgtttctcagaaa
actgcactaccactgcacctagtgcatcatcaggctttggctgtggcaggtttgagtccc
ttgctgagacggagtcattctccgacgttgttcacgcgtctgtgctccacacctcctgcg
agtcccagcggccgcggcgggggagggccgtgctaccagcccgttccgtctctgcggctg
gagggcagcggatcttatgagaaactcaacagcagcatgccgtctgtgaactgcagctcg
tggtacagtgacagtaacggcaaccacagcaggagtgtgcagaggacgcagcgacccgta
tccctcacggttcctccggtcacacgcagagactccacatccctgtcacacgggagcgcc
ggcagcctcgtggaggccgtgttgatatccgagggtttgggttgctatgcacaggatcct
tccttcatccaggtagcgaagcaggaactagcggatgcctgcgacatgaccatggaggag
atggagaacgctgccgacaacattctcaacgccaacgcaccgcccaatgccaacggaaac
ctgctacccttcatgcagtgcagagacactggctcgcaggagtcccgttgcagccacgcg
ctgggcctctcgaccaccacgggctccgacgagctgctgggggcggagctagagtgctcc
gagggggaggggcagcagaacagcactctgatggaggacggggacatggagtgcgtgacc
agtttgtag

DBGET integrated database retrieval system