KEGG   Sinocyclocheilus grahami: 107591725Help
Entry
107591725         CDS       T04918                                 

Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04145  Phagosome
sgh04210  Apoptosis
sgh04510  Focal adhesion
sgh04520  Adherens junction
sgh04530  Tight junction
sgh04810  Regulation of actin cytoskeleton
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107591725
  09143 Cell growth and death
   04210 Apoptosis
    107591725
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107591725
   04520 Adherens junction
    107591725
   04530 Tight junction
    107591725
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107591725
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107591725
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sgh03021]
    107591725
   03019 Messenger RNA biogenesis [BR:sgh03019]
    107591725
   03036 Chromosome and associated proteins [BR:sgh03036]
    107591725
   03029 Mitochondrial biogenesis [BR:sgh03029]
    107591725
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sgh04812]
    107591725
   04147 Exosome [BR:sgh04147]
    107591725
Transcription machinery [BR:sgh03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     107591725
Messenger RNA biogenesis [BR:sgh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107591725
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     107591725
    NuA4 complex
     107591725
  Chromatin remodeling factors
   BAF complex
    107591725
   PBAF complex
    107591725
   SWR1 complex
    107591725
Mitochondrial biogenesis [BR:sgh03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    107591725
Cytoskeleton proteins [BR:sgh04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     107591725
Exosome [BR:sgh04147]
 Exosomal proteins
  Proteins found in most exosomes
   107591725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 107591725
NCBI-ProteinID: XP_016136449
LinkDB All DBs
Position
Unknown
AA seq 375 aa AA seqDB search
MDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgaaattgccgcactggttgttgacaacggatccggtatgtgcaaagccgga
ttcgctggagatgatgctccccgtgctgtcttcccatccattgtgggtcgccccagacat
cagggtgtcatggttggtatgggacagaaggacagctacgttggtgatgaggctcagagc
aagagaggtatccttaccctgaagtaccccatcgagcacggtattgtcaccaactgggat
gatatggagaagatctggcatcacaccttctacaacgagctgcgtgttgccccagaggag
caccccgttctgctcacagaggcccccctgaaccccaaggccaacagggaaaagatgaca
cagatcatgttcgagaccttcaacacccccgccatgtacgttgccatccaggctgtgctg
tccctgtatgcctctggtcgtaccactggtatcgtgatggactctggtgatggtgtcacc
cacactgtgcccatctacgagggttacgccctgccccatgccatcctccgtctggacttg
gctggccgtgacctgactgactacctcatgaagatcctgaccgagagaggctacagcttc
accaccacagccgagagggaaattgtccgtgacatcaaggagaagctctgctatgtggct
cttgactttgagcaggagatgggcaccgctgcttcctcctcctccctggagaagagctat
gagctgcctgacggacaggtcatcaccattggcaatgagaggttcaggtgcccagaggcc
ctgttccagccatccttcttgggtatggagtcttgcggtatccatgagaccaccttcaac
tccatcatgaagtgtgatgttgacatccgtaaggacctgtatgccaacactgtattgtct
ggtggtaccactatgtaccctggcattgctgacaggatgcagaaagagatcacatccctg
gcccccagcacaatgaaaatcaagattattgccccacctgagcgtaaatactctgtctgg
atcggaggttccatcctggcctccctgtccaccttccagcagatgtggattagcaagcag
gagtacgatgagtctggaccatccatcgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system