KEGG   Sinocyclocheilus grahami: 107592291
Entry
107592291         CDS       T04918                                 

Definition
(RefSeq) cellular tumor antigen p53-like isoform X1
  KO
K04451  tumor protein p53
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04110  Cell cycle
sgh04115  p53 signaling pathway
sgh04137  Mitophagy - animal
sgh04210  Apoptosis
sgh04216  Ferroptosis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107592291
   04310 Wnt signaling pathway
    107592291
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107592291
  09143 Cell growth and death
   04110 Cell cycle
    107592291
   04210 Apoptosis
    107592291
   04216 Ferroptosis
    107592291
   04115 p53 signaling pathway
    107592291
   04218 Cellular senescence
    107592291
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107592291
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107592291
   03036 Chromosome and associated proteins [BR:sgh03036]
    107592291
   03400 DNA repair and recombination proteins [BR:sgh03400]
    107592291
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    107592291
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     107592291
DNA repair and recombination proteins [BR:sgh03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107592291
SSDB
Motif
Pfam: P53 P53_tetramer
Other DBs
NCBI-GeneID: 107592291
NCBI-ProteinID: XP_016137219
UniProt: A0A672QE47
LinkDB
Position
Unknown
AA seq 371 aa
MAESQEFADLWERNLISSQEGGPCWDLINDEQYLPGSFDLNIFSNVLTEQPRPSTSPPTA
SVPVATDYPGEHGFKLGFPQSGTAKSVTCTYSADLNKLFCQLAKTCPVQMVVDVAPPQGS
VIRATAIYKKSEHVAEVVRRCPHHERTPDGDALAPPAHLIRMEGNSRAVYREDDITYRHS
VVVPYEAPQLGAEWTTVLYNFMCNSSCMGGMNRRPILTIITLETHEGQLLGRRSFEVRVC
ACPGRDRKTEESNFRKDQETKTLGKTPSTTKRSMTKESSSSTPRPEGRRKAKLSASSDEE
IYTLQVRGKERYEMLKKINDSLELSDVVPPSDMDRYRQKLFTKGKKEKDGQTTEPKRSKK
LMLKDEKSDSD
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcagaaagtcaagaatttgctgacctgtgggagcgaaacctcatttccagtcaggaa
ggtggcccttgctgggacttgatcaatgatgagcagtatcttccagggtctttcgacctg
aatatttttagtaatgtgctgactgaacagcctcggccgtccacctcccctccgaccgcc
tctgttcctgttgccactgattatcctggggaacatggcttcaaactgggcttccctcaa
tctggcacagccaagtctgtcacctgcacgtactcggctgacctgaataagctcttttgc
caattggcgaaaacgtgtccagttcagatggtggtggacgttgcccctccccagggctcg
gtgatcagagccacagccatttataagaagtccgaacatgtggctgaggtggtccgtcga
tgtccccaccatgagagaaccccagatggcgatgcattggctcctcctgctcacctgatc
cgaatggaaggaaactcgcgtgctgtttacagagaggacgatataacctacaggcacagt
gtggtggttccctatgaagctcctcaactgggagcagaatggacaactgttttgtacaat
ttcatgtgcaacagcagttgcatgggtggcatgaaccgccgacccatcctcacgatcatc
actctggagactcatgaaggtcagttgctgggccgcaggtctttcgaggtgcgtgtgtgt
gcgtgcccaggcagagaccggaaaactgaggagagcaacttcaggaaagaccaggagacc
aaaaccttgggcaagaccccttctaccaccaaacgcagcatgactaaagaatcatcttca
tccacacctcgacctgagggcaggaggaaggccaaactgagcgcgagcagtgatgaggaa
atctataccctgcaggtgaggggtaaggaaaggtatgaaatgttgaagaagatcaacgac
agtttggaattgagcgacgtggtacctccatctgatatggacagataccggcagaaatta
ttcaccaagggcaagaaggagaaggatggccaaacgactgagcccaaaagaagcaaaaaa
ctaatgcttaaagatgaaaaaagtgactcggattag

KEGG   Sinocyclocheilus grahami: 107599945
Entry
107599945         CDS       T04918                                 

Definition
(RefSeq) cellular tumor antigen p53 isoform X1
  KO
K04451  tumor protein p53
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04110  Cell cycle
sgh04115  p53 signaling pathway
sgh04137  Mitophagy - animal
sgh04210  Apoptosis
sgh04216  Ferroptosis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107599945
   04310 Wnt signaling pathway
    107599945
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107599945
  09143 Cell growth and death
   04110 Cell cycle
    107599945
   04210 Apoptosis
    107599945
   04216 Ferroptosis
    107599945
   04115 p53 signaling pathway
    107599945
   04218 Cellular senescence
    107599945
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107599945
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107599945
   03036 Chromosome and associated proteins [BR:sgh03036]
    107599945
   03400 DNA repair and recombination proteins [BR:sgh03400]
    107599945
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    107599945
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     107599945
DNA repair and recombination proteins [BR:sgh03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107599945
SSDB
Motif
Pfam: P53 P53_tetramer
Other DBs
NCBI-GeneID: 107599945
NCBI-ProteinID: XP_016147180
LinkDB
Position
Unknown
AA seq 371 aa
MAESQEFADLWERNLISTQEAGTCWELISDEQYLPSSFDPNIFDNVLTEQPQPSTSPPSA
SVPVATDYPGEHGFKLGFPQSGTAKSVTCTYSPDLNKLFCQLAKTCPVQMVVEVAPPPGS
VIRATAIYKKSEHVAEVVRRCPHHERTPDGDGLAPAAHLIRVEGNSRALYREDDVNSRHS
VVVPYEAPQLGAEFTTVLYNFMCNSSCMGGMNRRPILTIITLETHDGQLLGRRSFEVRVC
ACPGRDRKTEESNFRKDQETKTLSKTPSANKRSLTKESASSVPRPEGSKKAKLSGSSDEE
VYTLQVKGKERFEMLKKINDSLELSDVVPPSEIDKYRQKLLTKGKKEKDGQTPEPKRGKK
LMVKDEKSDSD
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcagaaagtcaagaatttgctgacctgtgggagagaaacctcatttccactcaagaa
gccggcacttgctgggaattgatcagcgatgagcagtatcttccaagctccttcgatccc
aatatttttgataatgtgctgactgaacagcctcagccgtccacctcccctccgtccgcc
tctgttcctgttgccactgattatcctggggaacatggcttcaaactggggttcccgcaa
tctggcaccgccaagtctgtgacctgcacttactcgcctgatctgaataagcttttttgc
caattggcgaaaacttgtccagttcagatggtggtggaagttgcccctccgccgggctcg
gtgatcagagccacagccatttataagaagtccgaacatgtggctgaggtggtccgtcga
tgtccccaccatgagagaaccccagatggtgatggattggctcctgctgctcacctgatc
cgagtggaaggaaactcgcgtgctctttacagggaggatgatgtcaactcgaggcacagt
gtggtggttccctacgaagctcctcaactgggagcggagtttacaacggtgctatacaac
tttatgtgcaacagcagttgcatgggtggaatgaatcgccggcccatcctcacaatcatc
actctggagactcatgacggtcagttgctgggccgcaggtctttcgaggtgcgtgtgtgc
gcgtgcccaggcagagacagaaaaactgaggagagcaacttcaggaaagaccaggagacc
aaaaccttgagcaagaccccctctgctaataaacgtagtttgacgaaagagtcagcttca
tctgtgcctcgacctgagggcagtaaaaaggccaaactgagtgggagcagtgatgaagag
gtgtataccctgcaggtgaagggtaaagaaagatttgaaatgttgaagaagattaacgac
agtttggagttgagcgacgtggtgcctccatctgaaattgacaaataccgtcagaaatta
ctcaccaagggcaagaaagagaaggatggccaaacacctgagcccaaaagaggcaaaaaa
ctaatggttaaagatgaaaaaagcgactccgattag

DBGET integrated database retrieval system