KEGG   Sinocyclocheilus grahami: 107592916
Entry
107592916         CDS       T04918                                 

Gene name
nos2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00220  Arginine biosynthesis
sgh00330  Arginine and proline metabolism
sgh01100  Metabolic pathways
sgh04020  Calcium signaling pathway
sgh04146  Peroxisome
sgh04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107592916 (nos2)
   00330 Arginine and proline metabolism
    107592916 (nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107592916 (nos2)
   04020 Calcium signaling pathway
    107592916 (nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107592916 (nos2)
Enzymes [BR:sgh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107592916 (nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 Sfi1_C NAD_binding_6 Fer4_11
Other DBs
NCBI-GeneID: 107592916
NCBI-ProteinID: XP_016137980
LinkDB
Position
Unknown
AA seq 1127 aa
MGNQATKSNKNVILHQIKPNTQWENNNVILKQITPNTQLENNNVILKQITPNTQWENKKV
ILQQITTSTQWENKVNQCPFSKQVKNYQDGLCHQDTLHHRAVKSPICTSEVCEGSIMTPK
AMTRCPSSTLPGSDDILMQAIDFINQYYKSIKNSKIEEHLSRLEEVAKEIEATGSYQLTT
KELEFGAKQAWRNAPRCIGRVQWANLQLFDARKCRTAEDMFQMLCDHIQFATNGGNLRSA
ITVFPQRTDGQHDFRVWNSQLIRYAGYAMTDGTIIGDPASVDFTEICIQLGWTPKYGQFD
VLPLVLQANSEDPQFFEVPQHLILEVPMEHPQYKWFKDLNLRWYALPAVSNMLLEIGGLE
FPACPFNGWYMGTEIGVRDFCDTKRYNVLERVGRLMGLETQKLSSLWKDQALVAINVAVM
HSFQKNKVTITDHHSASESFMQHMEMEVRLRGGCPADWVWLVPPMSGSLTPVFHQEMLNY
ILSPFFYYQPDPWLTHKWKNKKRNVRKHTISFKGLIRVVLFSQILIKSALAKRVRCTVLY
ATETGKSQTFAKRLNTMMNCAFSSQVVCMEDYNFSELEKESLLIVVTSTFGNGDCPGNGE
SFKKQLLSLNNLRNKVRYCVFGLGSRMYPHFCAFAHAVDDRFAALGAIRVSATGEGDELN
GQEEAFSAWACTAFKDACKEFNIQGQLPGKEGLADSWDPQRHRVQNDSCTVDRITALSAL
HSKAVVPMKLKRKQNLQSPKSSRATILVELEMEGNTEHLNFVPGDHVGIFPGNSSELVAG
ILKHLANAPPINQSLSLEFLSAYPDGERWQRVERIPPCPLAQALTYYLDVTTPPSQSLLR
KLSNMAKLEDHRQRLLALATDFQVYATWKEFHKPTFLEVLDEFSSLELSAAFLLSQLPLV
KPRLYSISSSPDLHPEELHLTVAVVSYHTQEGKGPLHFGLCSAWLNTIKEGDMVPCFVHS
SDGFHLPSDPSAPCILVGVGSGIAPFRSFWQQQFHDMKKTGLKGNPVTLVFGCRGSDTDH
LYKEETLDMRDNGTLSSITTAYSRQTGQPKVYVQDILREQLSDKVFEVLHHNPGHLYICG
GMNMAHDVAATIKEILVNRQGITLTQAEEYLSRLKNEKRYHEDIFGS
NT seq 3384 nt   +upstreamnt  +downstreamnt
atggggaaccaagccactaaatccaacaagaatgtaatactgcaccagattaagccgaat
acgcaatgggagaacaataatgtaatactgaagcagattacgccgaatacgcaattggag
aacaataatgtaatactgaagcagattacgccgaatacgcaatgggagaacaagaaagta
attctgcagcagataacaacgagtacgcaatgggagaacaaggtgaatcaatgcccattt
tccaagcaagtgaagaactaccaggatggcttgtgccatcaggacacattacatcacaga
gcggttaagagcccgatttgcacgtctgaagtctgtgaaggctctattatgactccaaag
gctatgacgcgctgtccctcctccaccctgccaggctccgatgacatcctcatgcaagct
attgacttcatcaatcagtactacaagtcaattaaaaactcaaaaatcgaggagcacctg
tctcgtctggaggaagtcgcaaaggaaatagaggctactggctcatatcaactcaccaca
aaagaactggaatttggggctaagcaagcatggagaaatgcacctagatgcattggcaga
gttcagtgggctaatttgcagctgtttgatgcacgtaaatgcagaactgctgaggatatg
tttcagatgttgtgcgatcatattcagttcgctaccaatggaggcaacctgaggtctgcc
atcactgtgtttcctcaaagaactgatggccaacatgatttccgtgtatggaatagtcag
ctcatacgatacgctggctatgcgatgacagatggtacgataataggagatcctgccagt
gttgacttcacagagatttgcatccagcttggatggacaccaaagtatggtcaatttgat
gtgcttccactggtgttacaagctaacagtgaggaccctcagttttttgaagttccccaa
catttgattttggaagttcccatggagcacccacagtacaagtggtttaaggatttgaac
ctccgatggtatgcattgcctgcggtgtccaacatgttactggagattggtggtcttgaa
ttcccagcgtgtccttttaacggttggtacatgggcactgagattggagtgagggacttc
tgtgatacaaaacgctacaatgttcttgagcgggttggccgtctaatgggtttggagaca
caaaaactgtcctcgctatggaaggatcaggctctggtggccatcaatgtcgcagtgatg
catagttttcagaaaaataaggtcaccattaccgaccaccattctgcatcagagtccttc
atgcagcacatggagatggaggtacgtctgcgaggaggctgtcctgctgactgggtctgg
ctggtgccaccgatgtctggatctctaacccctgtgtttcaccaggaaatgctgaactac
attctgtcaccctttttctactaccagcctgatccgtggttgacacacaagtggaagaac
aagaagagaaatgtgaggaagcatacaatcagcttcaaaggactgatcagagtagtgctc
ttctctcagatactcattaaatcagccctggccaagagggtgcgttgcactgttctgtac
gccacagaaacagggaaatcacagacttttgctaagagactaaacaccatgatgaactgt
gccttcagctcccaggtcgtttgcatggaggactacaacttcagtgaacttgagaaggaa
agcctgttaattgttgtcaccagcacctttggcaatggagactgtccaggaaatggagag
agtttcaagaagcagcttctcagcctgaacaacctcagaaacaaagtcaggtactgtgtg
tttggtctcggctctcgaatgtacccacacttctgtgcgtttgcccatgcagtggatgat
aggtttgcagcactgggagccattcgtgtgtctgccacaggagagggagatgagctgaac
ggacaggaggaagctttctcagcctgggcttgcactgcctttaaggatgcatgcaaggag
tttaatattcaaggtcagcttccaggaaaagaaggtctggcagattcctgggatccacag
aggcacagagttcagaatgacagttgtacagttgaccgaatcacagctctgtcagctctc
cattctaaagctgtggttcccatgaaactaaagagaaagcagaatctacagagcccaaag
tcaagtcgtgctacaatattggtggagttagagatggaagggaacacagagcacttaaac
tttgtccctggagaccatgtagggatttttccagggaactcatctgaattagtagctggc
atcctgaagcatctggccaatgcccctcctataaatcagagcctaagcttggaattcctc
agtgcctaccctgatggtgaaaggtggcagagagttgaacgaataccaccatgtcctctt
gcccaagctcttacctactatctggatgtcaccaccccaccctcacaaagcctcctccgc
aaactctcaaatatggcaaagcttgaagatcacagacagcgcctgcttgcattagcaaca
gatttccaagtctacgcaacatggaaggagttccacaaacctactttccttgaggtgcta
gatgagttttcctctctggaactttctgctgcctttctcctcagccagctgcctttagtg
aagccacgtctctactccatcagctcctccccagacctccaccctgaggagctccacctc
actgtggccgtggtcagctatcacacacaggagggaaaaggtccgctgcattttggtctt
tgtagtgcctggctcaataccatcaaagaaggagacatggtgccatgttttgtccatagc
tctgatggtttccaccttccatccgaccctagtgctccctgtattcttgtgggagttggg
agcggcattgctccattccgtagcttttggcaacagcaattccatgacatgaaaaaaaca
ggtctgaaagggaatccagtgacactcgtgttcgggtgtcgaggttcagatactgatcat
ctttacaaagaagagactctagacatgagagataatggtaccctaagcagtatcacaaca
gcttactctaggcagactggacaacccaaggtttatgtccaagatatcttgcgagaacaa
ttgagtgacaaggtctttgaggttttgcaccataatccaggacatctgtatatctgtgga
ggcatgaacatggcccatgatgtggctgccactatcaaggaaatcctagtcaaccggcag
ggcatcactcttactcaggctgaggaatatctgtcaaggctcaagaatgaaaagcggtac
catgaggacatctttggatcttag

DBGET integrated database retrieval system