KEGG   Sinocyclocheilus grahami: 107593057
Entry
107593057         CDS       T04918                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
sgh  Sinocyclocheilus grahami
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 Ras_bdg_2 C1_2
Other DBs
NCBI-GeneID: 107593057
NCBI-ProteinID: XP_016138123
UniProt: A0A672QMG3
LinkDB
Position
Unknown
AA seq 358 aa
MAKCEFIELQDLTPDDRIELAPPLSRAGPTLERWSKEKVVRMVGERVRLEDPDWLTCKPG
QGHDFQPCSQTQLSWCDLCGEFIWGLYRQSLRCTHCNYTCHYRCQPFIQLDCSLNCDAVS
EQLNCCEDTIETDTNVDELVDWRKQELSVSEIQQKVKEYNAQVNSNLFMVLNRDGSYTGF
IKVQFKLARPVSLPPPQITSSSSGRDGGCREDKALKRRTSFYLPRDTVKHLHISSSTRAR
EVIEALLKKFTVVDNPAKFSLFERSERQNQVYLRKLADGERPLFLRLCAGPNEKVLGLVL
KENETGEVNWDAFSFPELQNFLRILQREEEDHVRQIVRRYALAGDKMKEALKNFGTPG
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggcaaaatgtgaatttattgaattgcaggacttgactccagatgaccgcatcgagtta
gcgccccctctgtcccgcgcaggacccactctggaaaggtggagcaaagagaaggtggtg
cggatggtgggggagcgcgtgcgtctggaggaccccgactggctgacgtgtaaaccgggc
cagggacacgacttccagccctgcagccagacacagctcagctggtgcgacctctgcggg
gagttcatctggggcctgtaccgccagagcctccgctgcacacactgtaattacacttgt
cactaccgctgtcaacccttcattcaactggactgcagcttgaactgcgacgccgtcagc
gaacagctaaactgctgcgaggacacgatcgagacggacactaatgtggatgagctagtg
gactggagaaaacaggagctgtctgtcagtgaaatacaacagaaagtgaaggaatacaac
gctcaggtcaacagtaacctcttcatggttctgaaccgtgatggatcttacactggcttc
ataaaggtccagtttaagctggcccggcccgtgtctctccctcctccacagatcacgtcc
tcctcctcgggacgggatgggggttgtcgggaagacaaagcactgaagcgtcgcacctca
ttctacctgcccagagacacggtcaaacacctgcacatcagctccagcacacgggccaga
gaggtcatcgaagccctgctgaagaaattcactgtggtggacaatccggccaagttctca
ctgtttgaacgcagcgaacgacagaaccaagtgtacttaaggaagttggcagatggtgag
cgtccacttttcctgcgtctgtgtgctggacccaacgagaaggtcctcggtttagtcctt
aaagagaatgaaacgggggaagtcaattgggatgcattcagttttcctgaacttcagaac
ttcctgcgcatcctgcagcgggaggaggaggatcacgtgcggcagatcgtgcggcgttac
gctctggccggagacaagatgaaagaggctctgaagaacttcggcacgccgggctga

DBGET integrated database retrieval system