KEGG   Sinocyclocheilus grahami: 107593178Help
Entry
107593178         CDS       T04918                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: zinc finger protein DZIP1L-like
  KO
K16470  zinc finger protein DZIP1
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107593178
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107593178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dzip-like_N zf-C2H2 zf-C2H2_12 zf-C2H2_4
Motif
Other DBs
NCBI-GeneID: 107593178
NCBI-ProteinID: XP_016138279
LinkDB All DBs
Position
Unknown
AA seq 769 aa AA seqDB search
MLGQFSPGEPYSALSTTPPLNPAHLLQPFRFRSRTEPIDWRRLSALDVERVERDMDVDML
QNFITTVTFCAVEGERCPNCRGPADPSLIKLLRMSQLSTEYLLHCQDLLSSQLSGLEERL
QAALSLVQRGEEQRAELEKNXQEAKQENRRRKKMISTQQLHLQASANHYHKCQFCEKSFV
NYSYLQAHVQRRHPEVTDAERQKKRKVEDMEDRIEELKEKLRLTQMQLQAERETESLRRQ
QEQEEQRRREQSEKEALERWKEEERRKSQQEIGELRQLFLQESKDMASKSSSIEAKLLVL
QNKEVGEANNVTLQEESDPEKELRENRERELKEKMARKKSEWKKKLQEAQNRHRQEKEEL
KSENARLVKALSVEKNSGSSLQKLQQQVVSLSSQLSQKDRLIKSQEEKVAPVVLQKAQDA
PEEPEEEDEESMEDSDEAQWKVLKLHKGKSELMKASRPILEESLEEKLENMGLRKGTKGI
SKQTFKSLSALLTGQRLQRYRQQPDLQNQTDNLAREVIRQVKSLQNSQGKLTPSTLKQGG
KKHSTLVKEKSLRSREDSKSSIQRAKSQQPQALIPTPPPHNPLFPPPPPPPRSNAPQNQT
PKTQPKKNGTPPFSSDEDESVEDSAYITSSRGRPSPSVRLVQSGSLLNPTAEPDWTDSEL
SEASDTPKLHKSPNAHGSVVQTLTRSLERQLSTPIKKLVGGTRVLPPSSPSPRPAIVKQR
ALSDEESDLELSSIKELTANRAGVHKSSEVGGTSGTSAWSSVASRPGAW
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgttgggccagttctcccctggtgagccctacagtgctctctctaccacaccacccttg
aatccagcacacctgcttcagcccttccgcttccgctcacgaactgagcccatagactgg
aggcgtctctctgctctcgacgtggagcgtgttgagcgagacatggatgttgatatgctt
cagaatttcattacgaccgtaacgttctgtgccgtggagggcgagaggtgtccaaactgt
cgaggacctgctgacccttctttgatcaaactgcttcgtatgtctcagctgagcactgag
tacctgctgcactgccaggacttgctgagctctcagctgtcaggactggaagagcgtctg
caggcagcactctctctggtccagcgaggagaagaacaacgagcagaacttgaaaaaaat
tagcaagaagccaaacaggagaatcgacggagaaaaaaaatgatttccactcaacagctc
cacctgcaggccagtgctaatcattatcacaagtgccagttctgtgaaaaatcatttgtc
aactactcttacttacaagcacatgttcagcgacgacatcctgaagttacagatgcagag
agacaaaagaagcggaaggtagaagatatggaagataggatagaagagctgaaggagaaa
ctgagattgacgcaaatgcagctacaagcagagagagaaacagaaagtttgaggcgtcag
caggaacaagaggagcagcgaaggagagaacagtcagagaaggaagcactggagagatgg
aaagaagaggagagaagaaaatctcagcaagaaattggagagctgagacagttgtttctc
caggagtctaaagacatggcaagcaagagctcatccatagaggctaaactgctagtgttg
cagaacaaagaggtgggtgaagctaataatgtcactttacaagaagagagtgaccctgag
aaagaactgagagaaaacagagagagagagctaaaagagaaaatggccaggaagaaaagt
gaatggaagaagaaattacaggaagcacagaacagacaccgacaggagaaagaagagctg
aagagtgagaatgccaggcttgtgaaggccttgtctgtggagaagaactctggctccagt
ctgcagaaacttcagcagcaggttgtctctctctcttctcagctgagccagaaggacaga
ctcatcaaatctcaggaggagaaggttgctccagtggttttgcaaaaagcccaagatgct
cctgaggaaccagaggaggaagatgaagagagcatggaggattcagatgaagcccagtgg
aaggttctaaagttacataaaggaaagtcagagctgatgaaagcgtctagacctattcta
gaagaatcactggaggagaaactggagaatatgggactgcggaagggtaccaagggtatc
tctaagcaaacttttaagagtctgagtgctctgttgactggccagcggctgcagagatac
agacagcagccagaccttcagaaccaaacagacaacctggcacgtgaggtcatcaggcaa
gtcaaaagcctacagaatagccaggggaaattaacacccagcactttaaaacagggggga
aagaaacattcaaccctagtgaaggaaaaaagcctccgatccagggaggactcaaagtca
tccattcagagggccaagagccagcagccacaagcacttattccaacacccccaccccac
aaccccctattcccccccccccccccccccccacgctccaatgcacctcagaatcagact
ccaaaaacacagccaaaaaagaatggcacaccacctttcagttcagatgaggatgagtca
gttgaggacagtgcctatatcaccagctcacggggcaggccttccccttccgtgcgcctt
gtccaatcaggatcactgctgaacccaacagctgagcctgattggacagacagtgaactg
tcagaggcttctgacacacccaaactccacaaaagtcccaatgcacatggttctgttgtc
caaacactgacaagaagtttggaaagacagctaagcacaccaatcaaaaagcttgtgggt
gggactagagttctgcccccatccagcccctcccctcgccctgccattgtaaaacagaga
gcgctgtctgatgaggagagtgacttggagctgtcctccataaaagagctaacagccaac
cgtgcaggagtacacaaaagttcagaggtcggcgggacctcagggaccagtgcgtggagt
tctgtggccagtagaccaggagcgtggtga

DBGET integrated database retrieval system