KEGG   Sinocyclocheilus grahami: 107593287
Entry
107593287         CDS       T04918                                 

Definition
(RefSeq) adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00230  Purine metabolism
sgh01100  Metabolic pathways
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04371  Apelin signaling pathway
sgh04540  Gap junction
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107593287
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107593287
   04020 Calcium signaling pathway
    107593287
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107593287
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107593287
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107593287
   04914 Progesterone-mediated oocyte maturation
    107593287
   04916 Melanogenesis
    107593287
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107593287
   04270 Vascular smooth muscle contraction
    107593287
Enzymes [BR:sgh01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107593287
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF3007
Other DBs
NCBI-GeneID: 107593287
NCBI-ProteinID: XP_016138425
LinkDB
Position
Unknown
AA seq 1031 aa
MSVNGTQDGPVTVAEPHTGGGVREITAARGGSLSLPRFMRLKFTPESLEKVYQTYFLRQR
QETLLVLIVFAALFNGYVVIMCAVVYSEDKLKTLAVAAGGLASDILLYILCRFRLLPESV
SRSLVPFALWLLITVHVLCYFSLNFAGFYAAGDTVGWQTFFLFSFFLTLPLPLAPIALLS
ALSCCAHTLLLGVTVAQRHQDKLQLTVLIRQLVANLMLYFAAVLVGMMSYFMADRKYRTA
FLEAKQSLEVSLTLKEQSQQQEELLLSILPKHIADEMLQGMKKEANQKSDAQQFNTMYMY
RHENVSILFADIVGFTQLSSAVTPKELVKLLNELFARFDKLAAQHHQLRIKILGDCYYCI
CGLPDYREDHAVCSIMMGLSMVEAISYVREKTQTEVDMRVGVHTGTVLGGVLGQKRWQFD
VWSTDVTVANKMESGGIPGRVHISQNTKDCLHSEFELEEGNGGERCEYLLEKGIDTYLVL
VSKDTPKTNGVTNGTGNFLQVINTTKPSGSYISVKNIPEESETLDLCVVSQQLQLANMTD
KGMEDEHLNQLLNKTLLERETKETLEERKTSVLSLRFEDSDLESRYSAEKERRTGVAFSC
CCVVLIFTSVMEILIDPQLIVNYVTLAVGELLLLILTLCSLAAIFPRVFPQRLVSFSQWI
DRTRWARNTWAMAAIFVLTMAEVADMLSCVQPPLVLLNSSSGVTLESLGDGGCAENPKHY
GYISVLSLVATVMLVQLSHVVKLALMLLVTIATGAVNIHSWMYIYDIYDFIRYLDYSYSV
VPTRYLLTVMIIIMMMSFYYFTRHVERQSRKLFLWKIEVHDQKEKVYEMRTYNEALVTNM
LPEHVAKHFLGSKMRDEELYSQSYDEIGVMFASIPNFSDFYTEEGINNGGIECLRILNEI
ISDFDSLLDRTEFRHITKIKTIGSTYMAASGVTPESNTNGYADRKIEDQSILERWQHFAD
LADFALAMKVLLGNLNKQSFNNFMLRIGLNKGGVLAGVIGARKPHFDIWGNTVNVASRME
STGVMGNIQVI
NT seq 3096 nt   +upstreamnt  +downstreamnt
atgtcggtgaacgggactcaggacggtccggttaccgtcgcggagccgcacactggcggt
ggcgtgcgcgagataacggcggcgcgtggcggctcgctgtctctgccgcgtttcatgcgt
ctcaagtttacaccggagtctctggagaaagtttatcagacgtactttctgcggcagcgg
caggagacgttactggtgctgatcgtgttcgcggccctctttaacggttatgtcgtaatc
atgtgcgcggtggtttactctgaggataaactgaagacgctcgcggtggcggcaggtggg
ctcgcgtcggatattctgctctatattttgtgccggttccgtttgctgccggagtccgtg
tcccggagcctcgtgccgttcgcgctctggctgctcatcacggtccacgtgctgtgttac
ttcagtttgaacttcgcgggattttacgcggccggtgacaccgtcggatggcagacattc
ttcctcttctccttcttcctcacgctcccgctgccgctcgcgcccatcgcgctcctgagt
gcgctctcgtgctgtgcgcacacgctgctgctgggagtcaccgtagcgcagagacatcag
gacaaactgcagctaacagtgctgatcagacagctggtggcgaatctgatgctgtatttt
gctgctgtgctggtgggcatgatgtcatatttcatggccgaccgtaagtaccgcacggcg
ttcctcgaggccaaacaatctctggaagtcagtcttacgctgaaggaacagagtcaacaa
caggaggaattgctgttgtccatcttgccgaagcacatagcagatgagatgcttcagggc
atgaagaaagaagccaatcagaaatcagatgctcagcagttcaacaccatgtacatgtac
cgccacgaaaacgtcagtatccttttcgcagacattgtaggttttacacagctgtcttct
gccgtgactccaaaagaacttgtaaaactactcaacgaactctttgctcgcttcgacaaa
ctagcagcacaacaccaccagctaaggatcaagattctgggagactgttattactgtata
tgcggtttgccagattatcgtgaagatcatgcggtctgctccattatgatgggcctgtct
atggtggaggccatctcatatgtgcgtgaaaaaactcagacagaagtggacatgcgtgta
ggtgtgcacacgggtaccgtacttggtggagtcctgggacagaagcgctggcagtttgat
gtctggtccactgatgttactgtggcaaacaagatggagtcaggaggcatcccagggcgt
gtgcacatctctcagaacacgaaggactgtttgcacagtgagtttgagctggaggagggc
aatggaggagagcgctgcgagtaccttctggagaaaggcatcgacacgtatctggtgctc
gtgtccaaagacactcccaaaacaaacggagtgaccaacggcacaggaaactttcttcag
gtgatcaacaccacaaaacccagcggcagctacatatcagtaaagaacatacctgaggag
tcagagacacttgacctgtgtgtggtttctcagcagctgcagttggccaatatgaccgat
aaagggatggaggacgagcatctgaaccagctgctgaataaaactctgctggagagagag
acaaaagagactctggaggagaggaagacgtcagttctgtctctgaggtttgaggactct
gatctggagtctcgttactcagcagagaaggagagacggacgggagttgcgttcagctgt
tgttgtgtcgttctgatcttcacctcagtcatggaaattctcatcgacccacagctgatt
gtgaattatgtgactctagctgttggtgagctgttactgctgattctgactctgtgttca
ctagcagctatctttcctcgagtcttcccccagaggctggtgtctttctcacagtggatc
gaccgcacacgctgggctcgtaacacatgggccatggctgccatatttgttctgaccatg
gctgaggtggccgatatgctgagctgtgttcagccccctctcgtgctgctgaactcctcg
tccggcgtgacgctcgagtctctgggtgacggcggatgcgctgagaaccccaaacactac
ggatacatatcagtgctgtcactcgtggcaaccgtcatgctcgtacagctcagccatgtg
gtcaagctggcgctcatgctgttggttaccatagcaacaggtgccgtaaacatccacagc
tggatgtacatttacgacatctacgatttcattcgctacctggactacagttattcagtg
gttcccaccagatatctgctgactgtgatgattatcatcatgatgatgagtttctactac
tttacacgtcacgtggaaagacagtcgcgtaaactgtttctgtggaagattgaggttcac
gatcagaaggagaaagtgtatgaaatgagaacgtacaacgaggcgctggtcactaacatg
cttcctgaacacgtggccaaacacttcctgggctccaagatgcgagatgaggaactttac
agtcagtcgtatgatgagatcggcgtgatgttcgcctctattcccaacttctctgacttt
tacacggaggagggtataaacaatggaggaatagaatgcctccgaatcctgaatgagata
atctctgactttgacagtcttctggatcgcacagagtttcgccacattacgaagatcaag
accatcggcagcacatacatggctgcatcaggcgtgacgccggagagcaacactaacgga
tacgcagaccgcaagatagaggatcagtccatcctggagcgctggcaacacttcgctgat
ttggcagactttgcactggctatgaaagtcttacttggaaacctaaacaaacagtcgttc
aataacttcatgctgcgcataggtctgaataaggggggtgtgttagctggagtgattggc
gctcgcaaacctcatttcgatatttggggaaacactgtaaatgtggccagtcgtatggag
tccactggggttatgggtaacattcaggtgatttaa

DBGET integrated database retrieval system