KEGG   Sinocyclocheilus grahami: 107593657Help
Entry
107593657         CDS       T04918                                 

Definition
(RefSeq) probable ATP-dependent RNA helicase ddx6
  KO
K12614  ATP-dependent RNA helicase DDX6/DHH1 [EC:3.6.4.13]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    107593657
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sgh03019]
    107593657
   03036 Chromosome and associated proteins [BR:sgh03036]
    107593657
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107593657
Messenger RNA biogenesis [BR:sgh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107593657
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     107593657
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    107593657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C ResIII CMS1
Motif
Other DBs
NCBI-GeneID: 107593657
NCBI-ProteinID: XP_016138972
LinkDB All DBs
Position
Unknown
AA seq 483 aa AA seqDB search
MATARTEIPSSVMPMSKQNGQSKPLTLQSGSLTSSTQSGKTPVMPQKGSSIHQSSGGIRF
GDDWKKCLQLPPKDLRVKTTDVTATKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIP
IVLSGRDILARAKNGTGKSGAYLIPLLERIDLKKDYVQAIVFVPTRELALQVSQISINMS
KHLGGVKIMATTGGTNLRDDIMRLDETVHVIIATPGRILDLIKKGVAKVDKAQMIVMDEA
DKLLSQDFVVLIEDIISFMPKKRQILLYSATFPSSVQKFMSKHLQKPYEINLMDELTLKG
ITQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKM
MQEYRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPRNAETYLHRIGRSGRY
GHLGLAINLITSEDRFNLKGTEDQLMTDIKPIPSSIDKNLYVAEFHTMNPDEEEAAHKAG
ELN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggctacagcgagaacagagatcccttcttcagtcatgccaatgagcaaacagaatgga
cagtccaagcccttgaccctccagtcaggatcgcttacttcctcaacacagtcaggaaaa
acacctgtgatgccccagaaaggaagcagtatacaccaaagcagtggcggtatcaggttt
ggtgatgactggaagaaatgcctgcagcttccaccgaaagacttgcgagtgaaaaccaca
gatgtgactgcaaccaaaggaaacgagtttgaagattactgccttaagagggaactgctg
atgggcatcttcgaaatgggctgggagaagccttcccctatccaggaagagagtattcct
attgtcttgtcagggagggacattcttgcccgagctaaaaatggcacaggtaaaagcgga
gcctacctcatccccctcttggaaaggattgacctgaagaaggactatgttcaagccata
gtgtttgtacctactcgtgagttggctcttcaggtgagccaaataagtatcaacatgagc
aagcaccttggtggcgtcaagattatggctacaacaggtggcactaacctgagggatgac
atcatgcgtcttgatgagactgtacatgttataatagctaccccaggaaggatccttgac
ttgataaagaaaggtgtggccaaggttgacaaagctcagatgattgtgatggatgaggct
gataagttgctttctcaagactttgtggtgctcattgaggacatcatcagcttcatgccc
aaaaaacgccagattctgctctattctgccactttccccagcagtgtgcagaagtttatg
tccaaacaccttcagaagccatatgaaatcaatctgatggatgagctgacactgaaaggc
atcactcagtactatgcttatgttacagaaagacagaaagtgcactgtctcaacacactg
ttctccagacttcaaatcaaccagtcaatcatcttctgtaactccacccaaagggtggaa
ctccttgccaagaagatcacacaactaggctattcctgcttttacatccatgccaagatg
atgcaggaatacagaaatcgtgtgttccatgacttcagaaacggactgtgtaggaacctg
gtctgcacagatcttttcacaagaggaattgacatccaggctgtcaatgtagtcatcaac
tttgacttccccagaaatgcagagacatatctgcaccgcattggtcgatcaggtaggtac
ggtcacctgggattggccattaacctgatcacctcagaagatcgtttcaacctaaagggc
actgaggaccagctgatgactgacataaagcccatacccagcagcattgacaagaacctg
tatgtggcggagtttcacaccatgaaccctgatgaagaggaggctgctcacaaagcaggc
gagcttaattaa

DBGET integrated database retrieval system