KEGG   Sinocyclocheilus grahami: 107594473Help
Entry
107594473         CDS       T04918                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
sgh04115  p53 signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04371  Apelin signaling pathway
sgh04510  Focal adhesion
sgh04530  Tight junction
sgh04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107594473
   04340 Hedgehog signaling pathway
    107594473
   04371 Apelin signaling pathway
    107594473
   04068 FoxO signaling pathway
    107594473
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107594473
   04115 p53 signaling pathway
    107594473
   04218 Cellular senescence
    107594473
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107594473
   04530 Tight junction
    107594473
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107594473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 107594473
NCBI-ProteinID: XP_016140018
LinkDB All DBs
Position
Unknown
AA seq 292 aa AA seqDB search
MEHQLFCCEVDTIRRAYQDSNLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIAPKMRKIV
STWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTKKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVRPSELLQMELLALNKLKWDLASVTPHDFIEHFLAKLPIHQSSKQILRK
HAQTFVALCATDVNFIASPPSMIAAGSVAAAVQGLYLKSSDSCLSSLNLTNFLSQVIRCD
PDCLRSCQEQIESLLESSLRQAQQHNISTETKRVEEDVDLSCTPTDVRDINI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggaacaccagttgttttgctgtgaagtggataccattagaagagcttaccaagatagc
aacctgttgaatgaccgagttttacagacaatgctcaaagcagaggaaaactatcttcca
tcaccaaattatttcaagtgtgttcagaaagaaatcgcacctaaaatgaggaaaatcgtc
tccacatggatgctcgaggtctgtgaagaacagaaatgcgaagaggaagtttttccgttg
gctatgaactacctggacagatttttatctgtggagcccaccaaaaagaccaggttacag
ctgttaggggcaacttgtatgtttttggcctctaagatgaaagagactgtgccactaaca
gcagagaagttgtgcatatacacggacaactccgtccgtcccagtgaattattgcaaatg
gaactgctggcactaaataaactgaagtgggatcttgcctcagtcacaccacatgatttc
attgaacacttcctcgccaaactgcctatacaccagagctccaagcagatattgcgcaag
cacgcccagacgtttgtggccctctgtgcaacagatgttaacttcatcgcaagccctcca
tccatgatcgcggccggcagcgttgcagcagcagtgcaggggttgtacctgaaaagcagc
gacagttgcctctcatccctgaacctcaccaacttcctctcacaagtcatcagatgtgac
cctgactgtctgcgatcgtgtcaggaacagatcgagtccctgctggaatctagtctcaga
caagctcagcagcacaacatctccacagagaccaaaagagtggaggaggacgtggacctc
tcttgcactcccacagacgtcagagacattaatatctga

DBGET integrated database retrieval system