KEGG   Sinocyclocheilus grahami: 107595276
Entry
107595276         CDS       T04918                                 

Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107595276
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107595276
Cytokines and growth factors [BR:sgh04052]
 Cytokines
  CSF and other factors
   107595276
SSDB
Motif
Pfam: EPO_TPO TssO
Other DBs
NCBI-GeneID: 107595276
NCBI-ProteinID: XP_016141111
LinkDB
Position
Unknown
AA seq 183 aa
MFHGSGLFALLLMVLEWTHPGLSSPLRPICDLRVLDHFIKEAWDAEAALRACKDACSVAT
NFTVPLTRVDYDVWEAMNIEERAQEVQSGIHVLNEAISSLQASNQTDVLQSHIDASISNI
ASIRQVLRSLSIPEYVPPTSGGEDKEMQKVFSISELFQVHINFLRGKVRLLLANAPVCHQ
GVS
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtttcacggttcaggactctttgccttactgctgatggtgctggagtggacccatcca
ggcctgtcctccccattacgccccatctgcgacctgcgcgtcctagaccatttcattaag
gaggcatgggatgcagaagctgctttgagagcttgtaaggatgcttgcagcgttgcaaca
aacttcactgttcccctgaccagagtagattatgatgtctgggaagcgatgaatatagag
gagcgagctcaagaggtccagtcaggcatacatgtgctgaacgaggccatcagctcacta
caggcatctaatcagactgatgtgctacagtcccacatagatgccagtattagcaacatt
gccagcatcagacaagtgctgcgaagtctcagcataccggaatatgtacctccaaccagt
ggtggagaagacaaagagatgcagaaagtattctcaatctcagagctgtttcaggtccac
atcaacttcctgcggggaaaagtacgtcttctgctcgccaatgcacctgtctgccatcaa
ggtgtcagctga

DBGET integrated database retrieval system