KEGG   Sinocyclocheilus grahami: 107595397Help
Entry
107595397         CDS       T04918                                 

Definition
(RefSeq) trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107595397
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     107595397
Peptidases [BR:sgh01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107595397
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107595397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 107595397
NCBI-ProteinID: XP_016141274
LinkDB All DBs
Position
Unknown
AA seq 246 aa AA seqDB search
MKALILLALFAVAYAAPLEEDDKIVGGFECTKNGVPYQVSLNSGYHFCGGSLITNNWVVS
AAHCYKSSIQVRLGEHNIDISEGTEQFISSQKIIRHPSYNSNTLDNDIMLIKLASTASLN
SYVQTVSLPSSCASAGSECLISGWGNMSATGSNYPSRLMCLWAPILSDTTCRNAYPGQIS
SNMFCAGFMEGGKDSCQGDSGGPVVCSNRLQGIVSWGYGCAQRNQPGVYTKVCNYVSWIN
TTINSN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcattcttctggctctgttcgctgtggcttatgctgctcctctggaggag
gatgacaagatcgtcggcggattcgagtgtactaagaatggtgttccataccaggtttcc
ctgaacagtggttaccacttttgcggtggctctctgatcaccaacaactgggttgtgtct
gctgctcactgttacaagtcctctatccaggtgcgtctgggtgagcacaacattgacatc
tctgagggcactgagcagttcatcagctcccaaaagatcatcagacaccccagttacaac
agcaacactctggacaatgacatcatgctgatcaagctggccagcaccgccagtctgaac
agctacgttcagaccgtctctctgccttcaagctgtgcttcagctggtagcgaatgcctg
atctctggatggggaaacatgagcgccactggaagcaactaccccagccgtctgatgtgc
ctgtgggctcctatcctgagtgacactacctgcagaaatgcctaccctggtcagatctcc
tccaacatgttctgcgctggcttcatggagggaggcaaggactcctgccagggtgactct
ggtggcccagtggtgtgcagcaaccggttgcagggtattgtgtcctggggttacggctgt
gcccagaggaaccaacctggtgtctataccaaggtctgcaactacgtctcctggatcaac
accaccatcaactccaactaa

DBGET integrated database retrieval system