KEGG   Sinocyclocheilus grahami: 107595576Help
Entry
107595576         CDS       T04918                                 

Definition
(RefSeq) protein Jumonji-like
  KO
K11478  protein Jumonji
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107595576
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    107595576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC ARID JmjN zf-C5HC2
Motif
Other DBs
NCBI-GeneID: 107595576
NCBI-ProteinID: XP_016141501
LinkDB All DBs
Position
Unknown
AA seq 1183 aa AA seqDB search
MNRERPKRNIIQKKFDDNDGIPWSEERVVRRVLYLSLKEFKTAQKSKVENGTGIVNGSFA
NGHLNGSGPKAGLFAGSCKSDRTQHAVQSKDCSHEYSIEEPVRKKPRLQAQRKFAQSHPC
SPNATPLKMLEAMPPNPAMLNHLTRRKPKTEDFLTFLCLRGSPALPSNMAYFGSAKDDED
VDEEEEEEEDSVSNAPASCQSTPRKSKGPNKCIANGHVFNGQTRAAEEHKSSLRARGRDN
GKEKNSVASARTSTTHNLRPNRAVREQKQQPSKMNRTSGASAVSSRKTRELRSPPTKAVK
YPKGHVTYTKARLLKEAKLSLSTHTRHTHTHPQHSNSGKAQTSHAKMQKQVLSPATAGRL
CGTDTFPPRRNGLRQSKRQLELAGDSLTGAEVEVKRVKVQVVPLETRSRKAAQETPVRSQ
MAGSQRPKRASAGKLMFTKQMHCKATTLAKNSPTTSTRDILKPANSPKISETPKTSNSLK
QGNPSNTTEPINQAEPKERGRRSAEVTEVPVFCPSTRDFHDLLTYMEFVRGQAEAYGLYR
VVPPADWRPECKLKEEMRFVSYVQHVNKLGRRWGPNVQQLACIRRHLRTQGINMEEPPLI
GGCELDLARFFQILNEMGGMQQVTDLKTWGRLADLLGIPRSAQDRLAKLQEAYCQYLLSY
DSLSPAQRAQLEKEVLAEKEALERRSGPLEGQGDISQHAALLLPRCEPKNGLVNGALHRS
RAREHLRELDPTAKTTRPRRLEKRGEDEGVINEHYKCIHRGKSFSLTTFYRAARNTMNTC
FSKEPDTAEVEREYWRLVEEKECHVAVHCGRVDTKTHGSGFPVGKSEPFSKHGWNLTVLP
NNSGSILRHLGAVPGVTIPWLNIGMVFSTLCWCRDQNSLPYIDYLHTGADCIWYCIPAEE
KSKLDKVVHTLLQANGTPGLEMLERNIMISPEVLRRKGVKVYRTVQQSGQFMVCFPGTFV
SKVCCGYSVSETVHFANPQWMKLGYEAAKDLKRRRIEEPFSTEKLLYQITTCERDNKQLM
NSVSSLIKDLRDAEISQRRDLFEAGLRLSARYGTHCESQADKKKQQRSRFTEDTADRRCQ
VCQHLCYLSMVVHESDNVVFCLECALRYIQKRRSPRGLKMMFRYTEEQISGLVNRVCGRA
LEKSGVKQKVVGTSKTPAKRSPRHKSSALIPLSSATSKNTGRT
NT seq 3552 nt NT seq  +upstreamnt  +downstreamnt
atgaatagggaaaggccgaagagaaatatcattcaaaagaaatttgatgataacgatggg
atcccgtggtcggaggagagagtggtccgccgggtgctctacctctcacttaaagagttt
aagacggctcagaagagcaaagtggagaatggcactggaatagttaatggctcctttgca
aatggtcatttgaacggttcgggacctaaagctgggctgttcgctggaagctgtaagtca
gaccggacacaacatgcagttcagagcaaagactgcagccatgagtactcaatagaggag
cctgtcagaaagaagccaagactgcaggctcagaggaagtttgctcagtctcatccctgt
tctcccaatgccaccccgctgaaaatgctggaggccatgcccccgaacccagccatgctc
aaccatctcacaagacgcaaacccaaaaccgaagacttccttaccttcctctgcctaaga
ggctctcctgcgttgcccagcaacatggcatactttggtagtgctaaagatgatgaagat
gtagatgaggaagaggaagaggaagaagacagtgttagcaatgcccctgcttcctgccag
tccactccacgcaagagcaaaggacccaacaaatgcattgccaatggtcatgtatttaat
ggacagacacgagctgctgaggaacacaagagcagtttaagggccagagggagagacaat
gggaaggagaagaattctgtagcatcagctaggacctccactacacacaatctgcgaccc
aacagggctgtacgagaacaaaaacaacagccctccaaaatgaacagaacatcaggagca
tctgctgtcagttctaggaagacaagagaactccgtagtcccccgaccaaagctgtgaaa
taccccaagggccacgtgacttacaccaaagccagactgctcaaagaggccaagctcagc
ctgagcacacacacacgccacacccacacacaccctcagcactccaactcaggaaaagcc
caaaccagccacgccaagatgcaaaaacaggtgctatcaccagcaaccgctgggaggctg
tgtgggacggacactttcccacccagacgaaatggactgagacagtcaaagaggcagttg
gagttagctggggatagtctgaccggagcagaggtcgaggttaagagggtcaaagtgcaa
gtggttcccttggagacgcggagtaggaaagcagctcaggagacgccggtgagatcgcaa
atggcaggatcacaacggcccaaacgggcctcggcggggaagctcatgttcactaaacag
atgcactgtaaagccaccactctggccaagaacagccccactacctcaacacgagacatt
ttgaagccagccaactcccccaaaatatcagaaacccccaaaacaagcaattctctaaaa
caaggcaatccttctaatacgactgagcccatcaaccaagctgagcctaaagagcgaggc
cggcgcagcgcggaggtcacggaggttcccgttttctgtccaagcacacgcgacttccac
gacctgttgacttacatggagtttgtgcgggggcaagcggaggcgtatgggttgtaccga
gttgttccgccggcggattggcgtcctgagtgtaagcttaaagaggagatgcgcttcgtc
tcgtacgtgcagcatgtgaacaagctgggcagacgctggggcccaaatgtacagcaactg
gcctgcatcaggagacacctgcggacacaaggcataaatatggaagagcctccacttata
gggggctgtgagctggacctggccagattcttccagatcctcaatgaaatggggggaatg
cagcaggtcacagacctgaagacgtggggccgtctcgccgatctgctgggcatcccgcgc
tcggctcaagatcggttggccaagctccaggaggcgtactgccagtacctgctctcatac
gactctctgtccccagcccagagggcccagctggagaaggaagtgctggcagagaaagag
gccctggagagaagaagtgggcccctagagggccagggagacatatcccagcatgccgct
ctgctgcttccacgctgcgagcccaaaaatgggctggtgaacggagcgttgcaccgcagc
agagcgcgtgagcacctcagagagctggaccccacggcgaagaccacccggccaagaaga
ctagagaagagaggggaggatgaaggggtgataaatgaacattacaagtgcatacacagg
ggaaagtcgttctcgctgacgacattctacagggcagccaggaacactatgaacacatgc
ttcagcaaagagccagacactgctgaagttgagagggagtactggagactggttgaggaa
aaggaatgccatgttgctgtgcactgtgggagggttgacacaaagactcatgggagtgga
tttcctgtgggaaagtctgagccattttcaaagcatggatggaatcttaccgtccttccc
aataactcaggatccatcttacgtcatcttggtgctgtgccaggagtgaccatcccctgg
ctgaacataggcatggtcttttctaccttatgctggtgtcgggaccagaacagccttccg
tatatagattacctacacactggtgctgactgcatttggtactgtattccagctgaagag
aaatccaaacttgacaaagtagtacacacactgctacaggctaacggcactccagggctg
gagatgctagagaggaacattatgatttctccagaggtgctccgtcgaaagggggtgaaa
gtgtaccggactgtgcaacagagtggtcagttcatggtatgtttcccagggacctttgtg
tctaaggtgtgttgtggctacagtgtctcagagaccgtgcacttcgccaatccccagtgg
atgaagctgggctacgaggcagctaaggaccttaaacggcgtcgtatcgaggagccattc
tccacagagaaactgctctaccagatcactacatgtgagcgggacaacaagcagctcatg
aattcagtctccagtctcatcaaagatctcagggatgcagagattagccagcgcagggat
ctgttcgaggccgggctccgtctgtctgcacgctatggcacacactgcgagtctcaagca
gacaagaagaagcagcagcgctccagatttacagaagacacggctgacaggcgctgccaa
gtgtgtcagcatctgtgttacctctccatggttgttcacgagagtgacaatgtggttttc
tgtctggaatgtgctctacgatacatccagaagcgcaggtccccccgtggcctcaagatg
atgtttcgttacactgaggagcagatcagcggtctggtgaatcgagtgtgtggcagagca
ctggagaagagtggagtgaagcagaaagtcgtgggcaccagcaagacaccagcaaaacga
agccccagacacaagagctccgccctaatccccctctccagcgccacctcaaagaacacc
ggccgcacctaa

DBGET integrated database retrieval system