KEGG   Sinocyclocheilus grahami: 107595716Help
Entry
107595716         CDS       T04918                                 

Definition
(RefSeq) trypsin-2-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107595716
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     107595716
Peptidases [BR:sgh01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107595716
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107595716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 107595716
NCBI-ProteinID: XP_016141700
LinkDB All DBs
Position
Unknown
AA seq 250 aa AA seqDB search
MEQVQSAVMRSLMFLVLLGAAFALDDDKIVGGYECTPYSQPWQVSLNSGYHFCGGSLVSE
YWVVSAAHCYMSRVEVRLGEHNIVVNEGSEQFISSEKVIRHPNFDSWILDSDIMLIKLSK
PATLNQYVQTVALPNGCAADGTMCSVTGWGNTMSSTADSNKLQCLEVPILSNSDCNNSYP
GMITDTMFCAGYLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAEKDHPGVYGKVCMFS
QWIADTMSNN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggttcaatcagcagtcatgaggtctttgatgttcctggtgctccttggagcc
gcctttgctctggatgatgacaagattgttggtggatatgagtgcacaccctattcccag
ccctggcaggtgtctctgaactctggctaccacttctgcggtggctctctggtcagcgag
tactgggttgtgtctgctgctcactgctacatgtcacgtgtggaggtccgtttgggcgag
cacaacatcgtagtaaatgagggatctgagcagttcatctcctctgagaaggtcatccgc
caccccaactttgactcctggatccttgacagtgacatcatgctgatcaagcttagcaag
cccgctaccctcaatcagtacgtgcagactgtggccctgcccaatggctgtgccgccgat
ggcactatgtgcagtgttactggctggggaaacaccatgagttccactgctgattccaac
aagcttcagtgtctggaggtccccatcctatccaacagcgactgtaacaactcctaccct
ggtatgatcaccgataccatgttctgtgctggatacctggagggaggaaaggactcttgc
cagggtgactctggtggccctgtggtgtgcaatggtgagctgcagggtattgtgtcctgg
ggttatggctgtgctgagaaggatcatcctggtgtctatggcaaggtctgcatgttcagc
caatggatcgccgacaccatgagtaacaactaa

DBGET integrated database retrieval system