KEGG   Sinocyclocheilus grahami: 107598935
Entry
107598935         CDS       T04918                                 

Gene name
adcy3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00230  Purine metabolism
sgh01100  Metabolic pathways
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04371  Apelin signaling pathway
sgh04540  Gap junction
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107598935 (adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107598935 (adcy3)
   04020 Calcium signaling pathway
    107598935 (adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107598935 (adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107598935 (adcy3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107598935 (adcy3)
   04914 Progesterone-mediated oocyte maturation
    107598935 (adcy3)
   04916 Melanogenesis
    107598935 (adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107598935 (adcy3)
   04270 Vascular smooth muscle contraction
    107598935 (adcy3)
Enzymes [BR:sgh01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107598935 (adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053
Other DBs
NCBI-GeneID: 107598935
NCBI-ProteinID: XP_016145862
UniProt: A0A672N1W0
LinkDB
Position
Unknown
AA seq 1119 aa
MHRNRAFSEPEYSAEYSADCSVTLPSDPGQAVGRTHEVTVRSSGCCLCLPRFMRLTFAPD
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVIVMCTVLYTSDKLASVAVASVGLAADVL
LYLLCRFGLLPDRVTRRLVPYVLWVLIAAQNFCYLGLNFARFHQPSDTVGWQAFFSFSFF
LTLPLRLTPIVLITAVSCGVHTLVLGVTIAQQQQEDIQGAALGRQLLANIVIYFCAITVG
VMSYYMADRKHRKAFLEARQSLEVKLNMEEQSQQQERLLLSILPKHIADEMLQDMKKEAS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSFCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYRDDHAACSIMMGLAMVEAISYVREKTQTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQNTLECLHGEFDVEPGNGGDRCE
YLKERGIETYLVVVPKGPVGKNGINGVKLSVTSSNGNSPLLINTTECNGSVHTACTTPEE
PEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQALKGKH
TNRLSLRFTDPELETRFSVEKEKQSGAAFSCSCVVLLFTAIMEALIDPWLVANYVTLAVG
EVLLLILTICSLAAIFPRVFPKRLVSFSTWIDHTRWARNTWAMAAIFIVTMADIVDMLSC
RPPESSTNEATAVTPVTRAASGCSENPKYYSYIAVLALIATTMLVQVSHMVKLTLMLLIT
GATGVVNIYSWRDIFDLYDLTRFKEYRVHLVPSKYTMSVMIFIMMVSFYYFSRHVEKLAR
TLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVM
FASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEPQFRCITKIKTIGSTYMAAS
GVTSDNNTNGYACMKKEAISDRERWQHLADLADFALAMKVTLMNINYQSFNNFMLRIGLN
KGGVLAGVIGARKPHFDIWGNTVNVASRMESTGVMGNIQVVEDCYCILKDYGFRFVRRGP
IFVKGKGELLTYFLKGREKQGSFINGSFVTLPHQVVDSS
NT seq 3360 nt   +upstreamnt  +downstreamnt
atgcaccggaaccgggccttttcggagcccgagtattctgcggagtattcggcggactgt
tcagtcaccctgccctcggacccggggcaggcagtgggacgcacccatgaggtgactgtg
cgcagctccggctgctgcctgtgtctgccgcggttcatgcgtctgaccttcgcgccggac
tctctggagaacctctaccagacctacttccgccggcagaggcacgagaccctgctggtg
ctggtggtgttcgcggccctcttcgactgctacgtcattgtgatgtgcactgtgctctac
acgagcgataagctggcgtctgtggccgtggcgtcggtggggctggcagcggacgtcctg
ctgtacctgctgtgccggttcggtctgctcccggaccgtgtgacgcgccgcctagtgccc
tatgtcttgtgggtgctcatagcggcccagaacttctgttacctaggactgaacttcgct
cgcttccatcagcccagcgacacggtgggctggcaggcgttttttagcttttccttcttt
ctgacgttgccgctacggctgacccctatagtgctcatcacagccgtgtcctgcggtgtg
cacacgctcgtcctgggcgtcacgattgcccagcagcagcaggaggacattcagggggcg
gctcttggaagacagttgctggccaacattgtgatctacttctgtgccatcaccgtgggc
gtcatgtcgtattacatggccgaccgcaaacaccgcaaggcctttctggaggcccggcag
tcgctggaggtgaagctcaacatggaggagcaaagtcagcagcaggagcgtctcctgctg
tccatcttacccaagcacattgcagacgagatgcttcaggacatgaagaaagaagccagt
cagaaagagatgcagcagtttaacaccatgtacatgtatcggcacgagaacgtcagtatt
ctgttcgcagacatcgtgggcttcactcagctgtcctcgttctgtagcgcgcaagagctg
gtgaagctgctgaacgaattgtttgcccgtttcgacaagctagcagctaaataccaccag
ttgaggatcaagattctgggcgactgctattactgtatttgtggccttccagattaccgt
gatgaccatgcggcctgctccatcatgatgggtttggccatggttgaggccatttcatac
gttcgagagaagacgcagacggacgtggacatgcgtgtcggggtgcattctgggacggtt
ttgggcggcgtgctcggacagaagcgctggcagtatgacgtgtggtcgactgacgtgacg
gtggctaacaagatggaggcaggaggaataccagggcgagtgcacatctcccagaatacc
ctggagtgtctgcatggagagtttgatgtggagccggggaacggaggagaccgctgcgag
tacctgaaggaaagaggcattgagacgtacttggtggtggtgcccaagggacccgtgggt
aaaaacggcatcaacggggtaaagctttcagtgacgtcgtctaatgggaattctccattg
ctgatcaacactacggagtgcaatgggagcgtccacacggcctgtaccacaccggaggag
ccggaggagctggacacgcgggtggtgaacccctcgtttccaaaccctcggcgtcgtttg
cgtctgcgtgatctggctgagagagtgattgacgctcaggagaacgaacaggagctcaac
aaactcctcaatgaagcgctgctggagcgcgagacagtacaggcgctgaaagggaagcac
actaatcgtctgtctctgcgctttactgatccggagctggagacgcgcttctcggtggag
aaggagaagcagagcggagcggcgtttagctgctcgtgtgtggtgctgctcttcactgcc
atcatggaggctctcattgacccctggttggttgcaaactatgtgactctggctgtaggt
gaagtcttgctactcattcttactatctgttcgctggcagctattttcccaagggtattt
ccaaagagactggtgtcgttctccacttggattgatcacacgcgctgggctcgcaacact
tgggccatggcggccatcttcatagtcacaatggccgacatagtagatatgttgagctgt
cgtccaccagagtcgtccaccaatgaggcgactgcggtcactccggtcactcgggccgcc
agcggctgttcggagaatcctaaatactacagctacatcgcagtgctggctctcatcgcc
accaccatgctggtgcaggtcagtcacatggtcaaactcaccctcatgctgctgatcacc
ggagctacaggtgtggtcaacatctacagctggagggacatctttgacctgtacgatctg
acgcgctttaaggaatacagagttcatcttgtgccctccaaatacaccatgagtgtgatg
atcttcatcatgatggtcagcttctactacttctcccggcatgtggagaagctggcacgc
actctgttcctgtggaagattgaagtgcatgagcagaaggagaaggtgtacgagatgcgg
cgctggaacgaggctctggtcactaatatgcttccggagcatgtcgcccggcatttcctg
ggctccaagaagagggatgaggagctctacagccagtcctacgatgagattggagttatg
ttcgcctccatcccaaacttctctgatttctatacagaggaaagcatcaacaatggcggg
attgagtgtctgaggttcctcaatgaaatcatttccgattttgatagccttttagacgag
ccgcagtttcgctgtataaccaagatcaagactattggcagcacctacatggcagcatca
ggagtcacttcagacaataacactaacggttatgcttgtatgaagaaagaagcgatttca
gaccgggaacggtggcagcacttggcagatcttgctgattttgctctggccatgaaagtc
acgttgatgaacatcaattaccagtccttcaataacttcatgctccgcatcgggttgaat
aaagggggcgttttggctggtgtgatcggggctcgtaaacctcattttgacatctgggga
aacactgtgaatgtcgccagtcgcatggagtccacaggggtgatgggaaacatccaggtg
gtggaggactgctactgcatcctgaaggactacggcttccgcttcgtcaggagaggaccc
atattcgtcaaggggaaaggagagctgctcacctacttcctaaagggacgtgaaaaacaa
ggctccttcattaacggctcttttgtcaccctgccgcaccaagtggtggacagctcttga

DBGET integrated database retrieval system