KEGG   Sinocyclocheilus grahami: 107600134Help
Entry
107600134         CDS       T04918                                 

Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9-like
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00512  Mucin type O-glycan biosynthesis
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    107600134
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sgh01003]
    107600134
Enzymes [BR:sgh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     107600134
Glycosyltransferases [BR:sgh01003]
 O-Glycan biosynthesis
  Mucin-type
   107600134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 107600134
NCBI-ProteinID: XP_016147421
LinkDB All DBs
Position
Unknown
AA seq 589 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSEELVQIGRLSDQRLRGRNAKVTNSMD
RQSILKRLERLEDVVYNQLNGLAKPMGLVEGPGGLGRSLREHCSKNPLPKAASPEKLAGQ
AMGQAGCKQLTYSDDLPQISVVFIFVNEALSVILRSVHSVVNHTPAHLLKEIILVDDNSD
SVELKFNLDHYVNKRYPGLVKIVRNSKREGLIRARIHGWNAATAPVVGFFDAHVEFNTGW
AEPILTRVKEDHTRIILPAIDNIKYNTFEVQQYANAAHGYNWGLWCMYIIPPQDWLDKGD
ETAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMRVWQCGGSMEVLPCAR
VAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEFKSHVYMAWNIPMNNPGVDFGDVSERV
ALRKKMNCRNFRWYLEHVYPEMRIYNNTITYGEVRNSKASGYCLDQGSEEDDRAILYPCH
GMSSQLARYTTEGLLQLGALGSTTFLPDTKCLVDDGRGKTPSLKKCDAVTRSSQRLWDFT
QNGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWIIRNWIKYPRH
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcacgcaagatcaaaactctgctgacggtcaacattctggtgttcgtcggg
atcatcttgttctccgtctactgcaggatccaggaccgatccgaagagctcgtgcagatc
gggaggctgtcggatcagagactgcgaggcaggaatgccaaagttacgaactccatggac
agacagtccattctcaaaaggctcgagcgactagaagatgtggtctataaccagttaaat
ggtctagccaagcccatgggtctggtggagggtcctggaggtctagggcgttctctgcga
gaacattgcagcaagaacccgctaccgaaggccgcctcacccgaaaagctggctggccag
gccatgggacaggcggggtgtaagcagttgacctactctgatgaccttccccagatctct
gtcgtcttcatttttgtgaacgaagctctctctgtcatcctgcggtctgtacacagcgtg
gtcaaccacaccccggcacacctgctcaaagaaatcatactggtggatgacaacagtgac
agcgtggagttgaagttcaatctggatcattacgtgaataagcgatatcccggcctggtg
aagatcgtgaggaacagtaaaagagagggacttatacgggccaggattcatggctggaac
gcagccactgctcctgttgtgggattctttgatgcccatgtggagttcaacacaggctgg
gctgagcctatcctcacaagagtgaaagaagatcacactaggataatcctccctgcgata
gataatatcaagtacaacacctttgaggtgcagcaatacgctaatgcagctcatggctac
aactggggcctctggtgcatgtacatcatcccaccacaggattggttggacaaaggcgat
gagactgcccccatcaggacacctgcaatgattggttgctcctttgtagtggatcgtgag
tattttggagaaattggactgcttgacccaggcatggaggtctatggaggagagaacatt
gaattgggtatgagggtgtggcagtgtggcggcagtatggaggttctcccgtgtgccaga
gtagctcacattgaacgcacaaagaaaccgtacaacaatgacattgactactatgccaag
cggaacgcgttgcgggcagcagaagtttggatggatgagtttaagtcccatgtctacatg
gcttggaatatccccatgaataacccaggagtggattttggagacgtgtcagagcgtgta
gcgctgagaaagaaaatgaactgcaggaactttcgctggtacctcgagcatgtctatcct
gagatgagaatttacaacaacaccatcacttatggagaggtgcgaaacagtaaagccagt
ggatactgccttgatcaggggtcagaggaggatgacagggccatactctacccatgtcac
ggcatgtcatcacagctggcaaggtacaccactgagggcttactgcagttaggagccctg
gggtcgactacgtttctgcctgatacaaaatgcctggtggatgatggaagaggaaagact
ccgagcttgaaaaaatgtgatgctgtcaccaggtcctcccagaggctctgggattttact
cagaatggacccatcataagtcgagacacaggacgttgtttggaggttgaaatgtcaaaa
gatgcaaactttggcctgcgactggtcgtccagcgctgctcagggcagaaatggattatt
cggaactggataaaataccccagacactga

DBGET integrated database retrieval system